Property Summary

NCBI Gene PubMed Count 6
Grant Count 3
R01 Count 3
Funding $295,758
PubMed Score 102.16
PubTator Score 41.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.500 0.002
posterior fossa group B ependymoma -4.500 0.000
oligodendroglioma -1.800 0.016
glioblastoma -2.400 0.005
group 4 medulloblastoma -3.200 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -2.600 0.002
colon cancer -1.800 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -2.400 0.000
Pick disease -1.500 0.006
pituitary cancer 1.700 0.008

Synonym

Accession Q9H169 B7Z2Z7 B7Z4I9 D3DSS8 D3DSS9 G5EA16 Q2TAB9
Symbols RB3

Gene

AA Sequence

MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTSGQSFEVILKP      1 - 70
PSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKM     71 - 140
AKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEEASR                         141 - 189
//

Text Mined References (8)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12676564 2003 Expression of stathmin family genes in human tissues: non-neural-restricted expression for SCLIP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9788875 1998 The stathmin phosphoprotein family: intracellular localization and effects on the microtubule network.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.