Property Summary

NCBI Gene PubMed Count 6
PubMed Score 113.06
PubTator Score 41.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.200 1.4e-05
astrocytic glioma -2.500 2.4e-03
Astrocytoma, Pilocytic -2.400 3.2e-10
atypical teratoid / rhabdoid tumor -3.800 1.8e-05
colon cancer -1.800 7.8e-05
ependymoma -4.000 2.3e-02
glioblastoma -1.900 4.4e-04
group 3 medulloblastoma -1.700 2.3e-02
medulloblastoma, large-cell -2.600 1.6e-03
oligodendroglioma -1.800 1.6e-02
Pick disease -1.500 5.6e-03
pituitary cancer 1.700 7.6e-03

AA Sequence

MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTSGQSFEVILKP      1 - 70
PSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKM     71 - 140
AKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEEASR                         141 - 189
//

Text Mined References (8)

PMID Year Title