Property Summary

NCBI Gene PubMed Count 92
Grant Count 85
R01 Count 44
Funding $10,088,637.89
PubMed Score 132.81
PubTator Score 138.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 4.900 0.000
astrocytic glioma -2.900 0.001
posterior fossa group A ependymoma -3.300 0.000
oligodendroglioma -3.000 0.001
esophageal adenocarcinoma -1.300 0.023
cutaneous lupus erythematosus -1.100 0.017
psoriasis -1.300 0.002
glioblastoma -2.800 0.000
osteosarcoma -3.531 0.001
atypical teratoid / rhabdoid tumor -2.600 0.000
group 4 medulloblastoma -2.800 0.002
medulloblastoma, large-cell -1.800 0.036
non-small cell lung cancer 2.517 0.000
lung cancer 4.700 0.000
colon cancer 1.300 0.000
sarcoidosis 1.600 0.012
adult high grade glioma -2.000 0.013
pilocytic astrocytoma -2.700 0.000
non primary Sjogren syndrome sicca -1.100 0.005
Breast cancer -2.900 0.000
COPD 1.200 0.029
lung carcinoma 3.000 0.000
breast carcinoma -1.100 0.000
ovarian cancer 1.900 0.002

Synonym

Accession Q9H165 D6W5D7 Q86W14 Q8WU92 Q96JL6 Q9H163 Q9H164 Q9H3G9 Q9NWA7 BCL-11A
Symbols EVI9
CTIP1
DILOS
ZNF856
HBFQTL5
BCL11A-L
BCL11A-S
BCL11a-M
BCL11A-XL

Gene

Gene RIF (76)

PMID Text
26816381 this study found that LRF/ZBTB7A transcription factor occupies fetal gamma-globin genes and maintains the nucleosome density necessary for gamma-globin gene silencing in adults, and that LRF confers its repressive activity through a NuRD repressor complex independent of the fetal globin repressor BCL11A.
26707798 These data suggest a possible role for BCL11A expression in acute myeloid leukaemia biology
26393293 Association has been found between variants at BCL11A erythroid-specific enhancer and fetal hemoglobin levels among sickle cell disease patients in Cameroon.
26375765 Extensive genetic analyses have validated BCL11A as a potent repressor of fetal hemoglobin level. Studies of BCL11A exemplify how contextual gene regulation may often be the substrate for trait-associated common genetic variation
26342260 only HbF inducer efficient in rescuing the ability to differentiate along the erythroid program, even in K562 cell clones expressing high levels of BCL11A-XL, suggesting that BCL11A-XL activity is counteracted by mithramycin.
26053062 a successful induction of gamma-globin includes a reduction in BCL11A, KLF1 and TAL1 expression.
25938782 the study of these rare patients and orthogonal genetic data demonstrates that BCL11A plays a central role in silencing HbF in humans and implicates BCL11A as an important factor for neurodevelopment
25703683 Common HbF BCL11A enhancer haplotypes in patients with African origin and Arab-Indian sickle cell anemia have similar effects on HbF but they do not explain their differences in HbF.
25574598 BCL11A has an important role in triple-negative breast cancer and normal mammary epithelial cells
25488618 The study compares polymorphism at BCL11A to HBS1L-MYB loci and explains less of the variance in HbF in patients with sickle cell disease in Cameroon.
More...

AA Sequence

MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQ      1 - 70
CNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSP     71 - 140
RSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPR    141 - 210
VGIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIE    211 - 280
RLGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGS    281 - 350
KPPFLATPPLPPLQSAPPPSQPPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKL    351 - 420
KRHMKTHMHKSSPMTVKSDDGLSTASSPEPGTSDLVGSASSALKSVVAKFKSENDPNLIPENGDEEEEED    421 - 490
DEEEEEEEEEEEEELTESERVDYGFGLSLEAARHHENSSRGAVVGVGDESRALPDVMQGMVLSSMQHFSE    491 - 560
AFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDGTVNGRGCSPGESASGGLSKKLLLGSPSSLS    561 - 630
PFSKRIKLEKEFDLPPAAMPNTENVYSQWLAGYAASRQLKDPFLSFGDSRQSPFASSSEHSSENGSLRFS    631 - 700
TPPGELDGGISGRSGTGSGGSTPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPY    701 - 770
KCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE         771 - 835
//

Text Mined References (97)

PMID Year Title
26816381 2016 Transcription factors LRF and BCL11A independently repress expression of fetal hemoglobin.
26707798 2016 BCL11A expression in acute myeloid leukemia.
26393293 2015 Association between Variants at BCL11A Erythroid-Specific Enhancer and Fetal Hemoglobin Levels among Sickle Cell Disease Patients in Cameroon: Implications for Future Therapeutic Interventions.
26375765 2015 Hemoglobin switching's surprise: the versatile transcription factor BCL11A is a master repressor of fetal hemoglobin.
26342260 2015 Development and characterization of K562 cell clones expressing BCL11A-XL: Decreased hemoglobin production with fetal hemoglobin inducers and its rescue with mithramycin.
26053062 2015 Variation in Gamma-Globin Expression before and after Induction with Hydroxyurea Associated with BCL11A, KLF1 and TAL1.
25938782 2015 BCL11A deletions result in fetal hemoglobin persistence and neurodevelopmental alterations.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25703683 2015 BCL11A enhancer haplotypes and fetal hemoglobin in sickle cell anemia.
25574598 2015 BCL11A is a triple-negative breast cancer gene with critical functions in stem and progenitor cells.
More...