Property Summary

NCBI Gene PubMed Count 45
PubMed Score 34.96
PubTator Score 827.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 8.0e-05
psoriasis 6694 1.1e-03
non primary Sjogren syndrome sicca 891 1.5e-02
Breast cancer 3578 2.7e-02
Disease Target Count Z-score Confidence
X-linked dystonia-parkinsonism 9 3.172 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.600 2.7e-02
non primary Sjogren syndrome sicca 1.400 1.5e-02
ovarian cancer -1.200 8.0e-05
psoriasis 1.200 1.1e-03

Gene RIF (29)

AA Sequence

MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKY      1 - 70
KKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKM     71 - 140
DSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAIDPN    141 - 210
EPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR    211 - 280
//

Text Mined References (47)

PMID Year Title