Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.92
PubTator Score 4.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q9H147 B2RA18 Q96DE3 Q9BQP2 Q9H148
Symbols Tdif1
C20orf167
dJ447F3.4

Gene

PDB

2MWI   4D6K  

Gene RIF (5)

PMID Text
25619743 In luciferase assays, TdIF1 can up-regulate transcription activity of the promoters containing the TdIF1-binding sequences, and this effect is mainly through the palindrome 5'-TGCATG-3'.
23874396 TdIF1 associates with the RAB20 promoter, and RAB20 gene transcription is reduced in TdIF1-knocked-down cells, suggesting that TdIF1 stimulates RAB20 gene transcription.
21258344 During cell division, DNTTIP1 is part of the mitotic deacetylase complex MIDAC, which also contains C14ORF43/MIDEAS and HDAC1/HDAC2.
21258344 During cell division, DNTTIP1 forms a complex with C14ORF43/MIDEAS and HDAC1/HDAC2.
17663723 The TdT binding, DNA binding and dimerization regions, and nuclear localization signal (NLS) in TdIF1, were identified.

AA Sequence

MGATGDAEQPRGPSGAERGGLELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSFTDPAISMDLL      1 - 70
RAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQAKLLFSDGEKVIPRLT     71 - 140
HELPGIKRGRQAEEECAHRGSPLPKKRKGRPPGHILSSDRAAAGMVWKPKSCEPIRREGPKWDPARLNES    141 - 210
TTFVLGSRANKALGMGGTRGRIYIKHPHLFKYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAAS    211 - 280
DDYRGCLDLKLEELKSFVLPSWMVEKMRKYMETLRTENEHRAVEAPPQT                         281 - 329
//

Text Mined References (20)

PMID Year Title
25653165 2015 Structural and functional characterization of a cell cycle associated HDAC1/2 complex reveals the structural basis for complex assembly and nucleosome targeting.
25619743 2015 Definition of the transcription factor TdIF1 consensus-binding sequence through genomewide mapping of its binding sites.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23874396 2013 TdIF1 recognizes a specific DNA sequence through its Helix-Turn-Helix and AT-hook motifs to regulate gene transcription.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21573134 2011 Nuclear cGMP-dependent kinase regulates gene expression via activity-dependent recruitment of a conserved histone deacetylase complex.
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...