Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $154,986.75
PubMed Score 2.76
PubTator Score 3.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma -1.300 0.000
osteosarcoma -1.097 0.000
medulloblastoma, large-cell -1.300 0.001
adrenocortical carcinoma -1.234 0.000
tuberculosis and treatment for 6 months 1.100 0.000
ovarian cancer 1.900 0.000

Gene RIF (3)

PMID Text
21292309 These findings suggest that GZF1 represents a new marker for renal proximal tubules.
17674968 The repressive activity of GZF1 is modulated by the level at which nucleolin is expressed.
14522971 induction of GZF1 expression via the is required for renal branching morphogenesis

AA Sequence

MESGAVLLESKSSPFNLLHEMHELRLLGHLCDVTVSVEYQGVRKDFMAHKAVLAATSKFFKEVFLNEKSV      1 - 70
DGTRTNVYLNEVQVADFASFLEFVYTAKVQVEEDRVQRMLEVAEKLKCLDLSETCFQLKKQMLESVLLEL     71 - 140
QNFSESQEVEVSSGSQVSAAPAPRASVATDGPHPSGLTDSLDYPGERASNGMSSDLPPKKSKDKLDKKKE    141 - 210
VVKPPYPKIRRASGRLAGRKVFVEIPKKKYTRRLREQQKTAEGDVGDYRCPQDQSPDRVGTEMEQVSKNE    211 - 280
GCQAGAELEELSKKAGPEEEEEEEEEDEEGEKKKSNFKCSICEKAFLYEKSFLKHSKHRHGVATEVVYRC    281 - 350
DTCGQTFANRCNLKSHQRHVHSSERHFPCELCGKKFKRKKDVKRHVLQVHEGGGERHRCGQCGKGLSSKT    351 - 420
ALRLHERTHTGDRPYGCTECGARFSQPSALKTHMRIHTGEKPFVCDECGARFTQNHMLIYHKRCHTGERP    421 - 490
FMCETCGKSFASKEYLKHHNRIHTGSKPFKCEVCFRTFAQRNSLYQHIKVHTGERPYCCDQCGKQFTQLN    491 - 560
ALQRHRRIHTGERPFMCNACGRTFTDKSTLRRHTSIHDKNTPWKSFLVIVDGSPKNDDGHKTEQPDEEYV    561 - 630
SSKLSDKLLSFAENGHFHNLAAVQDTVPTMQENSSADTACKADDSVVSQDTLLATTISELSELTPQTDSM    631 - 700
PTQLHSLSNME                                                               701 - 711
//

Text Mined References (9)

PMID Year Title
21292309 2011 Analysis of glial cell line-derived neurotrophic factor-inducible zinc finger protein 1 expression in human diseased kidney.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
17674968 2007 Nucleolin modulates the subcellular localization of GDNF-inducible zinc finger protein 1 and its roles in transcription and cell proliferation.
16049025 2005 GDNF-inducible zinc finger protein 1 is a sequence-specific transcriptional repressor that binds to the HOXA10 gene regulatory region.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14522971 2003 Identification of a novel glial cell line-derived neurotrophic factor-inducible gene required for renal branching morphogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.