Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.56
PubTator Score 20.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -3.700 2.1e-07
astrocytic glioma -3.200 2.0e-03
Astrocytoma, Pilocytic -3.900 2.4e-16
atypical teratoid / rhabdoid tumor -4.400 1.6e-13
Breast cancer 3.300 2.2e-02
cystic fibrosis and chronic rhinosinusit... 1.013 6.0e-03
ependymoma -3.600 2.7e-03
glioblastoma -3.400 1.5e-11
group 3 medulloblastoma -1.100 4.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.8e-02
lung carcinoma 1.900 7.6e-31
medulloblastoma, large-cell -2.900 4.9e-06
oligodendroglioma -2.600 1.6e-02
osteosarcoma 1.633 1.7e-04
ovarian cancer -1.500 4.1e-07
Pick disease 1.300 1.6e-06
primitive neuroectodermal tumor -2.400 8.6e-06
progressive supranuclear palsy 1.100 1.5e-02

 OMIM Phenotype (1)

AA Sequence

MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAANMFKMAKNWSAAGNAFCQAAK      1 - 70
LHMQLQSKHDSATSFVDAGNAYKKADPQEAINCLNAAIDIYTDMGRFTIAAKHHITIAEIYETELVDIEK     71 - 140
AIAHYEQSADYYKGEESNSSANKCLLKVAAYAAQLEQYQKAIEIYEQVGANTMDNPLLKYSAKDYFFKAA    141 - 210
LCHFIVDELNAKLALEKYEEMFPAFTDSRECKLLKKLLEAHEEQNSEAYTEAVKEFDSISRLDQWLTTML    211 - 280
LRIKKSIQGDGEGDGDLK                                                        281 - 298
//

Text Mined References (13)

PMID Year Title