Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.21
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 0.00262673231996535
non primary Sjogren syndrome sicca 840 0.0176151797328575

Synonym

Accession Q9H112 Q0VAF2 Q0VAF3 Q8WXU5 Q8WXU6 Q9H113
Symbols SC13
CST8L
CTES2
dJ322G13.6

Gene

  Ortholog (8)

Gene RIF (1)

PMID Text
12072414 CST11 is an antimicrobial peptide that has shown to be effective against E. coli.

AA Sequence

MMAEPWQALQLLLAILLTLMALPYQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRV      1 - 70
LKVQRQVTDHLEYHLNVEMQWTTCQKPETTNCVPQERELHKQVNCFFSVFAVPWFEQYKILNKSCSSD       71 - 138
//

Text Mined References (10)

PMID Year Title
20565543 Evolution and human tissue expression of the Cres/Testatin subgroup genes, a reproductive tissue specific subgroup of the type 2 cystatins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12072414 2002 Cystatin 11: a new member of the cystatin type 2 family.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9007972 1997 Friends and relations of the cystatin superfamily--new members and their evolution.
8179826 1994 The human type 2 cystatin gene family consists of eight to nine members, with at least seven genes clustered at a single locus on human chromosome 20.
7896273 1994 Direct mapping of seven genes encoding human type 2 cystatins to a single site located at 20p11.2.
7690606 1993 Genomic cloning, physical mapping, and expression of human type 2 cystatin genes.
3202964 1988 Cystatin superfamily. Evidence that family II cystatin genes are evolutionarily related to family III cystatin genes.