Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.55
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.6e-03
non primary Sjogren syndrome sicca 891 1.8e-02

Gene RIF (1)

AA Sequence

MMAEPWQALQLLLAILLTLMALPYQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRV      1 - 70
LKVQRQVTDHLEYHLNVEMQWTTCQKPETTNCVPQERELHKQVNCFFSVFAVPWFEQYKILNKSCSSD       71 - 138
//

Text Mined References (10)

PMID Year Title