Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.21
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
12072414 CST11 is an antimicrobial peptide that has shown to be effective against E. coli.

AA Sequence

MMAEPWQALQLLLAILLTLMALPYQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRV      1 - 70
LKVQRQVTDHLEYHLNVEMQWTTCQKPETTNCVPQERELHKQVNCFFSVFAVPWFEQYKILNKSCSSD       71 - 138
//

Text Mined References (10)

PMID Year Title
20565543 Evolution and human tissue expression of the Cres/Testatin subgroup genes, a reproductive tissue specific subgroup of the type 2 cystatins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12072414 2002 Cystatin 11: a new member of the cystatin type 2 family.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9007972 1997 Friends and relations of the cystatin superfamily--new members and their evolution.
8179826 1994 The human type 2 cystatin gene family consists of eight to nine members, with at least seven genes clustered at a single locus on human chromosome 20.
7896273 1994 Direct mapping of seven genes encoding human type 2 cystatins to a single site located at 20p11.2.
7690606 1993 Genomic cloning, physical mapping, and expression of human type 2 cystatin genes.
3202964 1988 Cystatin superfamily. Evidence that family II cystatin genes are evolutionarily related to family III cystatin genes.