Property Summary

NCBI Gene PubMed Count 35
PubMed Score 26.37
PubTator Score 15.68

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
gastric carcinoma 1.400 4.0e-02
malignant mesothelioma 3.100 8.3e-09
osteosarcoma -3.949 1.8e-05
posterior fossa group B ependymoma 1.100 6.5e-06
psoriasis -1.200 1.1e-03

Gene RIF (23)

AA Sequence

MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQ      1 - 70
TGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGL     71 - 140
TPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAA    141 - 210
VPQALSAAAPAGTTFVQYQAPQLQPDRMQ                                             211 - 239
//

Text Mined References (35)

PMID Year Title