Property Summary

NCBI Gene PubMed Count 31
Grant Count 24
R01 Count 24
Funding $1,107,409.56
PubMed Score 20.80
PubTator Score 15.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 3.100 0.000
psoriasis -1.200 0.001
osteosarcoma -3.949 0.000
posterior fossa group B ependymoma 1.100 0.000
gastric carcinoma 1.400 0.040

Gene RIF (19)

PMID Text
26740055 RBM38 and DND1 are repressed in primary acute myeloid leukemia, neutrophil differentiation is dependent on increased expression of both proteins, and they have a role in regulating p21(CIP1) expression during acute promyelocytic leukemia differentiation
26046131 RNPC1 was found to be expressed in bladder, blood, brain, breast, colorectal, eye, head and neck, lung, ovarian, skin and soft tissue cancer. In 14 of the 94 tests, an association between RNPC1 gene expression and cancer prognosis was observed.
25622105 our data suggest that RBM38 is a novel translational regulator of HIF1alpha under a hypoxic condition.
24884756 Suggest that RNPC1 had a potential function to play a tumor-suppressor role which may be a potential marker in the therapeutic and prognostic of breast cancer.
24663081 Data indicate that long non-coding RNA HOTAIR is functionally related to RNA binding motif protein 38 (RBM38).
24250749 A role for RBM38 in regulating alternative splicing during erythroid differentiation.
24142875 GSK3 promotes p53 mRNA translation through phosphorylation of RNPC1
23912475 Data suggest that RNPC1 is a critical regulator of Mdm2.
23836903 knockdown of MIC-1 can decrease RNPC1-induced cell growth suppression.
22798430 RBM38 as novel transcriptional target of E2F1 restricts E2F1-induced proliferation. Furthermore, this negative feedback loop seems to restrict tumor aggressiveness, thereby promoting survival of patients with cancer.
More...

AA Sequence

MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQ      1 - 70
TGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGL     71 - 140
TPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAA    141 - 210
VPQALSAAAPAGTTFVQYQAPQLQPDRMQ                                             211 - 239
//

Text Mined References (31)

PMID Year Title
26740055 2016 The RNA binding proteins RBM38 and DND1 are repressed in AML and have a novel function in APL differentiation.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
26046131 2015 Integrative genomic analyses of the RNA-binding protein, RNPC1, and its potential role in cancer prediction.
25622105 2015 Hypoxia-inducible factor 1 alpha is regulated by RBM38, a RNA-binding protein and a p53 family target, via mRNA translation.
24884756 2014 RNA-binding protein RNPC1: acting as a tumor suppressor in breast cancer.
24663081 2014 Long non-coding RNA HOTAIR promotes cell migration and invasion via down-regulation of RNA binding motif protein 38 in hepatocellular carcinoma cells.
24250749 2013 The RNA binding protein RBM38 (RNPC1) regulates splicing during late erythroid differentiation.
24142875 2013 Glycogen synthase kinase 3 promotes p53 mRNA translation via phosphorylation of RNPC1.
23912475 2013 Regulation of Mdm2 mRNA stability by RNA-binding protein RNPC1.
23836903 2013 RNPC1, an RNA-binding protein and a p53 target, regulates macrophage inhibitory cytokine-1 (MIC-1) expression through mRNA stability.
More...