Property Summary

NCBI Gene PubMed Count 22
Grant Count 4
R01 Count 4
Funding $216,222.01
PubMed Score 13.84
PubTator Score 18.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 0.036
osteosarcoma -1.384 0.000
tuberculosis 1.400 0.000
group 4 medulloblastoma -1.100 0.004
subependymal giant cell astrocytoma 1.107 0.045
ovarian cancer 1.200 0.000

Gene RIF (4)

PMID Text
26151773 3 novel miRNAs, MIR4458, MIR4667-5p, and MIR4668-5p, regulate autophagy-mediated elimination of B. pseudomallei by targeting ATG10
23850577 results suggest that genetic variants in ATG10 may implicate with breast cancer susceptibility in Chinese population. Further large and functional studies are needed to confirm our findings
23285162 Increased expression of ATG10 in colorectal cancer is associated with lymphovascular invasion and lymph node metastasis indicating that ATG10 may be a potential prognostic maker in colorectal cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLP      1 - 70
MEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRL     71 - 140
LQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAK    141 - 210
ATSQDERNVP                                                                211 - 220
//

Text Mined References (25)

PMID Year Title
26151773 2015 Burkholderia pseudomallei survival in lung epithelial cells benefits from miRNA-mediated suppression of ATG10.
23850577 2013 Potentially functional polymorphisms in ATG10 are associated with risk of breast cancer in a Chinese population.
23285162 2012 Increased expression of ATG10 in colorectal cancer is associated with lymphovascular invasion and lymph node metastasis.
22174682 2011 IRGM is a common target of RNA viruses that subvert the autophagy network.
21367888 2011 Human adenovirus type 5 induces cell lysis through autophagy and autophagy-triggered caspase activity.
20723759 2010 ATG12 conjugation to ATG3 regulates mitochondrial homeostasis and cell death.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17256008 2007 Regulation of autophagy by the inositol trisphosphate receptor.
More...