Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.33
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.631 0.000
spina bifida 1.083 0.040
ovarian cancer 1.400 0.000

Synonym

Accession Q9H0X9 A6NDP0 A6NJS8 B4DVB0 Q54A90 Q8N596 Q9BZB0 Q9P1Z4 ORP-5
Symbols ORP5
OBPH1

Gene

Gene RIF (7)

PMID Text
26206935 ORP5 and ORP8 could mediate PI4P/phosphatidylserine (PS) countertransport between the endoplasmic reticulum (ER) and the plasma membrane (PM), thus delivering PI4P to the ER-localized PI4P phosphatase Sac1 for degradation and PS from the ER to the PM.
25963840 Results show that OSBPL5 and CALU were expressed at higher levels in the lung tissues of metastasis-positive cases than that in the metastasis-negative cases suggesting they can promote invasiveness of lung cancer cells.
21220512 ORP5 may cooperate with NPC1 to mediate the exit of cholesterol from endosomes/lysosomes.
20644730 Telomeric NAP1L4 and OSBPL5 of the KCNQ1 cluster, and the DECORIN gene are not imprinted in human trophoblast stem cells.
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19032366 OSBPL5 is relatd to invasion and poor prognosis in pancreatic cancer.
12504849 OBPH1/Obph1 gene is imprinted, with preferential expression from the maternal allele in human and mouse.

AA Sequence

MKEEAFLRRRFSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATK      1 - 70
VPPAEYRLCNGSDKECVSPTARVTKKETLKAQKENYRQEKKRATRQLLSALTDPSVVIMADSLKIRGTLK     71 - 140
SWTKLWCVLKPGVLLIYKTPKVGQWVGTVLLHCCELIERPSKKDGFCFKLFHPLDQSVWAVKGPKGESVG    141 - 210
SITQPLPSSYLIFRAASESDGRCWLDALELALRCSSLLRLGTCKPGRDGEPGTSPDASPSSLCGLPASAT    211 - 280
VHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEE    281 - 350
LGELGEASQVETVSEENKSLMWTLLKQLRPGMDLSRVVLPTFVLEPRSFLNKLSDYYYHADLLSRAAVEE    351 - 420
DAYSRMKLVLRWYLSGFYKKPKGIKKPYNPILGETFRCCWFHPQTDSRTFYIAEQVSHHPPVSAFHVSNR    421 - 490
KDGFCISGSITAKSRFYGNSLSALLDGKATLTFLNRAEDYTLTMPYAHCKGILYGTMTLELGGKVTIECA    491 - 560
KNNFQAQLEFKLKPFFGGSTSINQISGKITSGEEVLASLSGHWDRDVFIKEEGSGSSALFWTPSGEVRRQ    561 - 630
RLRQHTVPLEEQTELESERLWQHVTRAISKGDQHRATQEKFALEEAQRQRARERQESLMPWKPQLFHLDP    631 - 700
ITQEWHYRYEDHSPWDPLKDIAQFEQDGILRTLQQEAVARQTTFLGSPGPRHERSGPDQRLRKASDQPSG    701 - 770
HSQATESSGSTPESCPELSDEEQDGDFVPGGESPCPRCRKEARRLQALHEAILSIREAQQELHRHLSAML    771 - 840
SSTARAAQAPTPGLLQSPRSWFLLCVFLACQLFINHILK                                   841 - 879
//

Text Mined References (29)

PMID Year Title
26206935 2015 INTRACELLULAR TRANSPORT. PI4P/phosphatidylserine countertransport at ORP5- and ORP8-mediated ER-plasma membrane contacts.
25963840 2015 Identification and evaluation of metastasis-related proteins, oxysterol binding protein-like 5 and calumenin, in lung tumors.
23934110 2013 Interactome map uncovers phosphatidylserine transport by oxysterol-binding proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21220512 2011 A role for oxysterol-binding protein-related protein 5 in endosomal cholesterol trafficking.
20644730 2010 Telomeric NAP1L4 and OSBPL5 of the KCNQ1 cluster, and the DECORIN gene are not imprinted in human trophoblast stem cells.
20201924 2010 Genome-wide association study of alcohol dependence implicates a region on chromosome 11.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19032366 2008 Oxysterol binding protein-related protein-5 is related to invasion and poor prognosis in pancreatic cancer.
More...