Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.13
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 8.4654684950889E-5
malignant mesothelioma 3163 9.86094254524854E-5
group 3 medulloblastoma 2254 0.0098272418111882

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
group 3 medulloblastoma -1.900 0.010
posterior fossa group B ependymoma -1.500 0.000

Synonym

Accession Q9H0X6 A2BFA0
Symbols

Gene

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG

AA Sequence

MPSDPGPEAGSGWPGLLMSCLKGPHVILKMEAMKIVHPEKFPELPAAPCFPPAPRPTPTLAPKRAWPSDT      1 - 70
EIIVNQACGGDMPALEGAPHTPPLPRRPRKGSSELGFPRVAPEDEVIVNQYVIRPGPSASAASSAAAGEP     71 - 140
LECPTCGHSYNVTQRRPRVLSCLHSVCEQCLQILYESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSI    141 - 210
LSRLPPEALTAPSGGQWGAEPEGSCYQTFRQYCGAACTCHVRNPLSACSIM                       211 - 261
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24105792 2014 Protein microarray characterization of the S-nitrosoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.