Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.13
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.900 9.8e-03
malignant mesothelioma 1.300 9.9e-05
posterior fossa group B ependymoma -1.500 8.5e-05

Synonym

Accession Q9H0X6 A2BFA0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

AA Sequence

MPSDPGPEAGSGWPGLLMSCLKGPHVILKMEAMKIVHPEKFPELPAAPCFPPAPRPTPTLAPKRAWPSDT      1 - 70
EIIVNQACGGDMPALEGAPHTPPLPRRPRKGSSELGFPRVAPEDEVIVNQYVIRPGPSASAASSAAAGEP     71 - 140
LECPTCGHSYNVTQRRPRVLSCLHSVCEQCLQILYESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSI    141 - 210
LSRLPPEALTAPSGGQWGAEPEGSCYQTFRQYCGAACTCHVRNPLSACSIM                       211 - 261
//

Text Mined References (10)

PMID Year Title