Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.22
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 9.07420175180359E-12
ependymoma 2514 5.22015088054369E-7
primitive neuroectodermal tumor 3031 6.98428002279828E-7
atypical teratoid / rhabdoid tumor 4369 1.71027677172238E-6
medulloblastoma 1524 1.7318303922718E-6
adrenocortical carcinoma 1427 1.63227252709768E-5
Pick disease 1893 2.35789779847503E-5
ovarian cancer 8492 1.07709170446497E-4
ulcerative colitis 2087 1.61008756959397E-4
medulloblastoma, large-cell 6234 2.79415233155586E-4
pilocytic astrocytoma 3086 2.79435423251983E-4
glioblastoma 5572 5.05885765277305E-4
adult high grade glioma 2148 5.86375433861463E-4
acute quadriplegic myopathy 1157 5.99119713152174E-4
tuberculosis and treatment for 6 months 686 0.00178585352470224
oligodendroglioma 2849 0.0251334457741027
aldosterone-producing adenoma 664 0.0274500594346021
astrocytic glioma 2241 0.0492302258985715

Expression

  Differential Expression (18)

Synonym

Accession Q9H0W9 A8K850 Q6FI88 Q6XYB0 Q96EI3 Q96IX1 Q9Y6B4
Symbols PTD012
PTOD012

Gene

PDB

1XCR  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid

AA Sequence

MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLP      1 - 70
LVNQKKVYDLNKIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGC     71 - 140
LLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYGNKPIGMGGTFIIQ    141 - 210
KGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDPGFDLRLEHTHFFSRHGEGGHYH    211 - 280
YDTTPDIVEYLGYFLPAEFLYRIDQPKETHSIGRD                                       281 - 315
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16522806 2006 Crystal structure of Homo sapiens PTD012 reveals a zinc-containing hydrolase fold.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
More...