Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.22
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.012 6.0e-04
adrenocortical carcinoma -1.478 1.6e-05
adult high grade glioma 1.200 7.2e-05
aldosterone-producing adenoma -1.331 1.9e-02
astrocytic glioma 1.300 4.9e-02
Astrocytoma, Pilocytic 1.100 2.2e-04
atypical teratoid / rhabdoid tumor 1.200 1.0e-04
ependymoma 1.100 5.2e-07
glioblastoma 1.200 4.9e-06
group 3 medulloblastoma 1.300 1.0e-02
medulloblastoma, large-cell 1.700 2.1e-05
non-small cell lung cancer -1.090 9.1e-12
oligodendroglioma 1.400 2.5e-02
ovarian cancer -1.300 1.1e-04
Pick disease 1.700 2.4e-05
primitive neuroectodermal tumor 1.100 2.7e-03
tuberculosis and treatment for 6 months -1.100 1.8e-03
ulcerative colitis -1.100 1.6e-04

AA Sequence

MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLP      1 - 70
LVNQKKVYDLNKIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGC     71 - 140
LLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYGNKPIGMGGTFIIQ    141 - 210
KGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDPGFDLRLEHTHFFSRHGEGGHYH    211 - 280
YDTTPDIVEYLGYFLPAEFLYRIDQPKETHSIGRD                                       281 - 315
//

Text Mined References (16)

PMID Year Title