Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.22
PubTator Score 12.90

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.1e-03
Breast cancer -2.600 1.5e-42
breast carcinoma -1.300 4.8e-04
ependymoma 1.400 3.5e-06
group 4 medulloblastoma -1.100 2.4e-03
invasive ductal carcinoma -1.400 8.4e-03
psoriasis -1.300 1.4e-33

Gene RIF (10)

AA Sequence

MLQIGEDVDYLLIPREVRLAGGVWRVISKPATKEAEFRERLTQFLEEEGRTLEDVARIMEKSTPHPPQPP      1 - 70
KKPKEPRVRRRVQQMVTPPPRLVVGTYDSSNASDSEFSDFETSRDKSRQGPRRGKKVRKMPVSYLGSKFL     71 - 140
GSDLESEDDEELVEAFLRRQEKQPSAPPARRRVNLPVPMFEDNLGPQLSKADRWREYVSQVSWGKLKRRV    141 - 210
KGWAPRAGPGVGEARLASTAVESAGVSSAPEGTSPGDRLGNAGDVCVPQASPRRWRPKINWASFRRRRKE    211 - 280
QTAPTGQGADIEADQGGEAADSQREEAIADQREGAAGNQRAGAPADQGAEAADNQREEAADNQRAGAPAE    281 - 350
EGAEAADNQREEAADNQRAEAPADQRSQGTDNHREEAADNQRAEAPADQGSEVTDNQREEAVHDQRERAP    351 - 420
AVQGADNQRAQARAGQRAEAAHNQRAGAPGIQEAEVSAAQGTTGTAPGARARKQVKTVRFQTPGRFSWFC    421 - 490
KRRRAFWHTPRLPTLPKRVPRAGEARNLRVLRAEARAEAEQGEQEDQL                          491 - 538
//

Text Mined References (20)

PMID Year Title