Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.78
PubTator Score 12.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 2.100 0.000
atypical teratoid / rhabdoid tumor 1.500 0.001
breast carcinoma -1.500 0.000
group 4 medulloblastoma -1.100 0.002
non-inflammatory breast cancer -2.600 0.000
invasive ductal carcinoma -1.400 0.008
psoriasis -1.300 0.000

Synonym

Accession Q9H0W5 Q8TB26
Symbols 3M3
p90
PPP1R20

Gene

PANTHER Protein Class (1)

PDB

4LG6  

Gene RIF (13)

PMID Text
26423533 HIV-1 Gag is relocalized by CCDC8 from the plasma membrane to the cytoplasm via endocytosis but not via the endolysosome pathway
26423533 HIV-1 Gag is relocalized by CCDC8 from the plasma membrane to the cytoplasm via endocytosis but not via the endolysosome pathway
26423533 HIV-1 Gag is relocalized by CCDC8 from the plasma membrane to the cytoplasm via endocytosis but not via the endolysosome pathway
26423533 HIV-1 Gag is relocalized by CCDC8 from the plasma membrane to the cytoplasm via endocytosis but not via the endolysosome pathway
26423533 HIV-1 Gag is relocalized by CCDC8 from the plasma membrane to the cytoplasm via endocytosis but not via the endolysosome pathway
26423533 HIV-1 infectivity is decreased by overexpression of CCDC8 in producer cells (HEK293T)
26423533 HIV-1 infectivity is decreased by overexpression of CCDC8 in producer cells (HEK293T)
24793695 The CUL7, OBSL1, and CCDC8 proteins form a 3M complex that functions in maintaining microtubule and genome integrity and normal development.
24711643 CUL7, OBSL1 and CCDC8 modulate the alternative splicing of the INSR
23018678 Mutations in CUL7, OBSL1 and CCDC8 in 3-M syndrome lead to disordered growth factor signalling.
More...

AA Sequence

MLQIGEDVDYLLIPREVRLAGGVWRVISKPATKEAEFRERLTQFLEEEGRTLEDVARIMEKSTPHPPQPP      1 - 70
KKPKEPRVRRRVQQMVTPPPRLVVGTYDSSNASDSEFSDFETSRDKSRQGPRRGKKVRKMPVSYLGSKFL     71 - 140
GSDLESEDDEELVEAFLRRQEKQPSAPPARRRVNLPVPMFEDNLGPQLSKADRWREYVSQVSWGKLKRRV    141 - 210
KGWAPRAGPGVGEARLASTAVESAGVSSAPEGTSPGDRLGNAGDVCVPQASPRRWRPKINWASFRRRRKE    211 - 280
QTAPTGQGADIEADQGGEAADSQREEAIADQREGAAGNQRAGAPADQGAEAADNQREEAADNQRAGAPAE    281 - 350
EGAEAADNQREEAADNQRAEAPADQRSQGTDNHREEAADNQRAEAPADQGSEVTDNQREEAVHDQRERAP    351 - 420
AVQGADNQRAQARAGQRAEAAHNQRAGAPGIQEAEVSAAQGTTGTAPGARARKQVKTVRFQTPGRFSWFC    421 - 490
KRRRAFWHTPRLPTLPKRVPRAGEARNLRVLRAEARAEAEQGEQEDQL                          491 - 538
//

Text Mined References (18)

PMID Year Title
26423533 2015 Inhibition of HIV-1 assembly by coiled-coil domain containing protein 8 in human cells.
25752541 2015 Ankyrin repeats of ANKRA2 recognize a PxLPxL motif on the 3M syndrome protein CCDC8.
24793696 2014 CUL9 mediates the functions of the 3M complex and ubiquitylates survivin to maintain genome integrity.
24793695 2014 The 3M complex maintains microtubule and genome integrity.
24711643 2014 Identifying biological pathways that underlie primordial short stature using network analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23018678 2012 Mutations in CUL7, OBSL1 and CCDC8 in 3-M syndrome lead to disordered growth factor signalling.
22156540 2011 The genetics of 3-M syndrome: unravelling a potential new regulatory growth pathway.
22084066 2011 Differential effects on p53-mediated cell cycle arrest vs. apoptosis by p90.
More...