Property Summary

NCBI Gene PubMed Count 18
PubMed Score 52.72
PubTator Score 5.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
psoriasis 6694 5.8e-05
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 1.4
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 5.8e-05

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSS      1 - 70
LWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQ     71 - 140
PGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYD    141 - 210
TFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTP    211 - 280
EEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY      281 - 348
//

Text Mined References (22)

PMID Year Title