Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 6
Funding $506,060.01
PubMed Score 6.75
PubTator Score 9.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.237 0.005
astrocytic glioma -2.700 0.008
ependymoma -2.700 0.016
oligodendroglioma -2.400 0.021
glioblastoma -3.700 0.000
osteosarcoma -1.125 0.000
medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -3.100 0.000
intraductal papillary-mucinous carcinoma... -1.100 0.050
Breast cancer 2.900 0.027
adult high grade glioma -2.900 0.000
pilocytic astrocytoma -2.400 0.000
subependymal giant cell astrocytoma -2.545 0.005
Pick disease -1.300 0.041
ovarian cancer -2.600 0.000

Gene RIF (6)

PMID Text
25449952 Results show that mutations and polymorphisms in the TSPYL1 gene were not associated with sudden infant death syndrome in a cohort of 165 deceased Swiss infants.
24412650 HIV-1 Vpr interacts with TSPYL1 and C20orf94 subunits of the SLX4 complex in Vpr-expressing THP-1 cells
22137496 Mutations in the TSPYL1 gene do not seem to play a major role in the pathogenesis of idiopathic male infertility, and mutation screening of the TSPYL1 gene can currently not be recommended in routine diagnostics of idiopathic male infertility.
19463995 Mutations in TSPYL1 may contribute to anomalies of testicular development/function.
16952470 The chromatin remodeling factor TSPYL1 had a very similar pattern of expression with an incremental increase in HPFH and decreased expression in deltabeta-thalassemia.
16418600 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGLDGVKRTTPLQTHSIIISDQVPSDQDAHQYLRLRDQSEATQVMAEPGEGGSETVALPPPPPSEEGGV      1 - 70
PQDAAGRGGTPQIRVVGGRGHVAIKAGQEEGQPPAEGLAAASVVMAADRSLKKGVQGGEKALEICGAQRS     71 - 140
ASELTAGAEAEAEEVKTGKCATVSAAVAERESAEVVKEGLAEKEVMEEQMEVEEQPPEGEEIEVAEEDRL    141 - 210
EEEAREEEGPWPLHEALRMDPLEAIQLELDTVNAQADRAFQQLEHKFGRMRRHYLERRNYIIQNIPGFWM    211 - 280
TAFRNHPQLSAMIRGQDAEMLRYITNLEVKELRHPRTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGRVVS    281 - 350
LSTPIIWRRGHEPQSFIRRNQDLICSFFTWFSDHSLPESDKIAEIIKEDLWPNPLQYYLLREGVRRARRR    351 - 420
PLREPVEIPRPFGFQSG                                                         421 - 437
//

Text Mined References (18)

PMID Year Title
25449952 2015 Variants in TSPYL1 are not associated with sudden infant death syndrome in a cohort of deceased infants from Switzerland.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
22137496 2012 Should TSPYL1 mutation screening be included in routine diagnostics of male idiopathic infertility?
21269460 2011 Initial characterization of the human central proteome.
19463995 2009 Mutations in the TSPYL1 gene associated with 46,XY disorder of sex development and male infertility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16952470 Identification of novel candidate genes for globin regulation in erythroid cells containing large deletions of the human beta-globin gene cluster.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16418600 2006 Genetic investigation of the TSPYL1 gene in sudden infant death syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...