Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.42
PubTator Score 9.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Sudden Infant Death with Dysgenesis of the Testes Syndrome 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 2.3

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.900 1.7e-05
astrocytic glioma -1.400 3.8e-03
Astrocytoma, Pilocytic -2.400 2.5e-07
atypical teratoid / rhabdoid tumor -3.900 3.6e-16
Breast cancer 2.900 2.7e-02
ependymoma -1.300 1.0e-02
glioblastoma -1.100 1.7e-06
group 3 medulloblastoma -2.000 9.4e-03
intraductal papillary-mucinous carcinoma... -1.100 5.0e-02
medulloblastoma, large-cell -3.900 6.6e-08
Multiple myeloma 1.237 5.2e-03
oligodendroglioma -1.100 1.1e-02
osteosarcoma -1.125 4.4e-04
ovarian cancer -2.300 1.1e-15
Pick disease -1.300 4.1e-02
primitive neuroectodermal tumor -3.100 4.6e-07
subependymal giant cell astrocytoma -2.545 4.6e-03

Gene RIF (6)

AA Sequence

MSGLDGVKRTTPLQTHSIIISDQVPSDQDAHQYLRLRDQSEATQVMAEPGEGGSETVALPPPPPSEEGGV      1 - 70
PQDAAGRGGTPQIRVVGGRGHVAIKAGQEEGQPPAEGLAAASVVMAADRSLKKGVQGGEKALEICGAQRS     71 - 140
ASELTAGAEAEAEEVKTGKCATVSAAVAERESAEVVKEGLAEKEVMEEQMEVEEQPPEGEEIEVAEEDRL    141 - 210
EEEAREEEGPWPLHEALRMDPLEAIQLELDTVNAQADRAFQQLEHKFGRMRRHYLERRNYIIQNIPGFWM    211 - 280
TAFRNHPQLSAMIRGQDAEMLRYITNLEVKELRHPRTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGRVVS    281 - 350
LSTPIIWRRGHEPQSFIRRNQDLICSFFTWFSDHSLPESDKIAEIIKEDLWPNPLQYYLLREGVRRARRR    351 - 420
PLREPVEIPRPFGFQSG                                                         421 - 437
//

Text Mined References (19)

PMID Year Title