Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.20
PubTator Score 2.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8519 3.5e-04
Breast cancer 3577 2.6e-02
non primary Sjogren syndrome sicca 891 4.1e-02


  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.500 2.6e-02
non primary Sjogren syndrome sicca 1.300 4.1e-02
ovarian cancer 1.400 3.5e-04

Gene RIF (1)

AA Sequence

INFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE                                  141 - 180

Text Mined References (19)

PMID Year Title