Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.20
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.500 0.026
non primary Sjogren syndrome sicca 1.300 0.041
ovarian cancer 1.400 0.000

Synonym

Accession Q9H0U6 Q5TAP9 Q9NZW8 L18mt
Symbols L18mt
HSPC071
MRP-L18

Gene

PDB

3J7Y  

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRT      1 - 70
VFPSREFWHRLRVIRTQHHVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAG     71 - 140
INFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE                                  141 - 180
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21685364 2011 Biological significance of 5S rRNA import into human mitochondria: role of ribosomal protein MRP-L18.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...