Property Summary

NCBI Gene PubMed Count 39
PubMed Score 36.31
PubTator Score 29.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
astrocytoma 1.100 0.003

Synonym

Accession Q9H0U4 A8K7S1
Symbols

Gene

PDB

3JZA   3NKV   4HLQ   4I1O   5SZH   5SZK  

 GO Function (1)

 MGI Term (1)

Gene RIF (14)

PMID Text
26977884 RAB1B localization to the Golgi.
25970785 RAB1B acts as a metastasis suppressor in triple-negative breast cancer by regulating the TGF-beta/SMAD signaling pathway and RAB1B may serve as a biomarker of prognosis and response to anti-tumor therapeutics for patients with triple-negative breast cancer.
23325787 Our results show, for the first time, that changes in Rab1b levels modulate gene transcription and strongly suggest that a Rab1b increase is required to elicit a secretory response.
23288104 The crystal structure of the Rab1b-LepB complex.
23236136 The detailed molecular reaction mechanism of a complex between human Rab and RabGAP at the highest possible spatiotemporal resolution and in atomic detail, is described.
23188820 results indicate that the cellular localization of MTMR6 is regulated by Rab1B in the early secretory and autophagic pathways
22260459 Overexpression of TBC1D20, RAB1A, or RAB1B results in abnormal HIV-1 gp41 migration, suggesting that a precise regulation of the RAB1/TBC1D20 axis is necessary for proper HIV-1 gp41 processing
21680502 Rab1a/b and Rab43, are important for herpes simplex virus 1 virion assembly
21093099 Rab1b is a key regulatory component of COPII dynamics and function.
20980813 Antibacterial autophagy occurs at omegasomes and reveal that the Rab1 GTPase plays a crucial role in mammalian autophagy.
More...

AA Sequence

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF      1 - 70
RTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFA     71 - 140
DSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC             141 - 201
//

Text Mined References (49)

PMID Year Title
26977884 2016 PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion.
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
25970785 2015 Loss of RAB1B promotes triple-negative breast cancer metastasis by activating TGF-?/SMAD signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
23325787 2013 Rab1b overexpression modifies Golgi size and gene expression in HeLa cells and modulates the thyrotrophin response in thyroid cells in culture.
23288104 2013 Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
23236136 2012 Catalytic mechanism of a mammalian Rab·RabGAP complex in atomic detail.
23188820 2013 Phosphatidylinositol 3-phosphatase myotubularin-related protein 6 (MTMR6) is regulated by small GTPase Rab1B in the early secretory and autophagic pathways.
22307087 2012 Reversible phosphocholination of Rab proteins by Legionella pneumophila effector proteins.
More...