Property Summary

NCBI Gene PubMed Count 44
PubMed Score 37.31
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Myocardial Ischemia 169 0.0 0.0
Disease Target Count P-value
astrocytoma 1146 2.6e-03
Disease Target Count Z-score Confidence
Legionnaires' disease 20 3.952 2.0
Warburg micro syndrome 18 3.755 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
astrocytoma 1.100 2.6e-03

 MGI Phenotype (1)

Protein-protein Interaction (7)

Gene RIF (17)

AA Sequence

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF      1 - 70
RTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFA     71 - 140
DSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC             141 - 201
//

Text Mined References (55)

PMID Year Title