Property Summary

NCBI Gene PubMed Count 22
Grant Count 15
R01 Count 1
Funding $2,388,227
PubMed Score 20.72
PubTator Score 54.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (8)

PMID Text
26617690 evaluation of MAGT1 and AKAP13 expression in clinical hepatocellular carcinoma tissues by immunohistochemistry suggested that both proteins were strongly expressed in tumor tissues with significantly higher average immunoreactive scores of Remmele and Stegner (IRS) than in non-tumor tissues
24130152 A 0.8 kb intronic duplication in MAGT1 and a single base pair deletion in the last exon of ATRX were identified in a family with five males demonstrating intellectual disability (ID) and unusual skin findings (e.g., generalized pruritus).
22190034 HIV-1 gp120 is identified to have a physical interaction with magnesium transporter 1 (MAGT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21983175 A deficiency in magnesium transporter 1 (MAGT1), an Mg(2+)-specific transporter, leads to the absence of a T cell antigen receptor-stimulated Mg(2+)flux and an attenuation of T cell activation.
21627970 Data show that gene expression of the Mg(2+) selective transporter MagT1 is upregulated in TRPM7(-/-) cells.
19717468 MagT1 is universally expressed in all tissues and its expression level is up-regulated in low extracellular Mg(2+). Knockdown of either MagT1 or TUSC3 protein significantly lowers the total and free intracellular Mg(2+) concentrations in cell lines.
18455129 study shows that mutations in two OTase-subunit genes, N33/TUSC3 and IAP result in autosomal-recessive nonsyndromic mental retardation
15804357 identifed a novel gene that encodes a protein involved with Mg2+-evoked transport, MagT1; results suggest that MagT1 may provide a selective and regulated pathway for Mg2+ transport in epithelial cells[MagT1]

AA Sequence

MAARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPR      1 - 70
NYSVIVMFTALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFI     71 - 140
NFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNM    141 - 210
EFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVT    211 - 280
LGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS                   281 - 335
//

Text Mined References (26)

PMID Year Title
26617690 2015 Up-regulation of AKAP13 and MAGT1 on cytoplasmic membrane in progressive hepatocellular carcinoma: a novel target for prognosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25135935 2014 Oxidoreductase activity is necessary for N-glycosylation of cysteine-proximal acceptor sites in glycoproteins.
24130152 2014 Variant ATRX syndrome with dysfunction of ATRX and MAGT1 genes.
23871722 2013 XLID-causing mutations and associated genes challenged in light of data from large-scale human exome sequencing.
21983175 2011 Loss of MAGT1 abrogates the Mg2+ flux required for T cell signaling and leads to a novel human primary immunodeficiency.
21796205 2011 Second messenger role for Mg2+ revealed by human T-cell immunodeficiency.
21627970 2011 The Mg2+ transporter MagT1 partially rescues cell growth and Mg2+ uptake in cells lacking the channel-kinase TRPM7.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
More...