Property Summary

NCBI Gene PubMed Count 24
PubMed Score 37.48
PubTator Score 54.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.051 7.5e-05
adult high grade glioma 1.400 1.6e-03
astrocytoma 1.200 3.9e-15
Astrocytoma, Pilocytic 1.900 1.2e-07
atypical teratoid / rhabdoid tumor 1.700 2.1e-06
Breast cancer 2.900 2.7e-02
breast carcinoma 1.800 1.3e-02
ependymoma 1.800 4.6e-10
glioblastoma 1.600 4.9e-07
group 4 medulloblastoma -1.500 6.2e-04
juvenile dermatomyositis 1.026 7.5e-08
medulloblastoma, large-cell -1.600 2.3e-03
Multiple myeloma 1.440 2.2e-03
osteosarcoma 2.715 1.0e-03
ovarian cancer -1.700 7.4e-06
pancreatic ductal adenocarcinoma liver m... -2.695 9.8e-03
Pick disease 1.200 1.9e-03
pituitary cancer -1.400 2.9e-05
subependymal giant cell astrocytoma 1.683 2.2e-02

Gene RIF (8)

AA Sequence

MAARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPR      1 - 70
NYSVIVMFTALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFI     71 - 140
NFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNM    141 - 210
EFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVT    211 - 280
LGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS                   281 - 335
//

Text Mined References (29)

PMID Year Title