Property Summary

NCBI Gene PubMed Count 27
PubMed Score 20.75
PubTator Score 7.61

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
gastric carcinoma -1.100 1.6e-02
nephrosclerosis -1.419 1.5e-02
non-small cell lung cancer -1.335 6.4e-14
pituitary cancer -1.400 3.1e-06
primary Sjogren syndrome -1.100 8.9e-03
ulcerative colitis -1.100 8.9e-04

Gene RIF (7)

AA Sequence

MAQAHRTPQPRAAPSQPRVFKLVLLGSGSVGKSSLALRYVKNDFKSILPTVGCAFFTKVVDVGATSLKLE      1 - 70
IWDTAGQEKYHSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLSQER     71 - 140
EVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQELLQRSDEEGQALRGDAAVALNKGPARQAKCC    141 - 210
AH                                                                        211 - 212
//

Text Mined References (29)

PMID Year Title