Property Summary

NCBI Gene PubMed Count 26
Grant Count 4
R01 Count 4
Funding $209,667
PubMed Score 20.85
PubTator Score 7.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
nephrosclerosis -1.419 0.015
non-small cell lung cancer -1.335 0.000
primary Sjogren syndrome -1.100 0.009
gastric carcinoma -1.100 0.016
ulcerative colitis -1.100 0.001
pituitary cancer -1.400 0.000

Gene RIF (6)

PMID Text
26191189 Down-regulation of Rab17 promotes tumourigenic properties of hepatocellular carcinoma cells via Erk MAPK signaling.
25707355 Rab17 might act as a tumour suppressor gene in hepatocellular carcinoma , and the anti-tumour effects of Rab17 might be partially mediated by the Erk pathway.
25052408 These results suggest that Rab17 and Rab17-mediated REs are involved in Streptococcus pyogenes-containing autophagosome-like vacuole formation.
22328529 Knockdown of either Rab17 or liprin-beta2 restores invasiveness of ERK2-depleted cells, indicating that ERK2 drives invasion of MDA-MB-231 cells by suppressing expression of these genes.
21291502 Data reveal new functions for recycling endosomes and Rab17 in pigmentation through a distal step in the process of melanosome release via filopodia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAQAHRTPQPRAAPSQPRVFKLVLLGSGSVGKSSLALRYVKNDFKSILPTVGCAFFTKVVDVGATSLKLE      1 - 70
IWDTAGQEKYHSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLSQER     71 - 140
EVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQELLQRSDEEGQALRGDAAVALNKGPARQAKCC    141 - 210
AH                                                                        211 - 212
//

Text Mined References (28)

PMID Year Title
26191189 2015 Down-regulation of Rab17 promotes tumourigenic properties of hepatocellular carcinoma cells via Erk pathway.
25707355 2015 Rab17 inhibits the tumourigenic properties of hepatocellular carcinomas via the Erk pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25052408 2014 Rab17-mediated recycling endosomes contribute to autophagosome formation in response to Group A Streptococcus invasion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22328529 2012 ERK2 drives tumour cell migration in three-dimensional microenvironments by suppressing expression of Rab17 and liprin-?2.
21291502 2011 The recycling endosome protein Rab17 regulates melanocytic filopodia formation and melanosome trafficking.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...