Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.15
PubTator Score 5.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H0S4 B3KXP4 G5E955 Q96GM0 Q96NV8 Q9UI98
Symbols RRP3
E4-DBP
HQ0256
MSTP162

Gene

PDB

3BER  

Gene RIF (2)

PMID Text
22174317 HIV-1 Rev interacting protein, DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 (DDX47), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with DDX47 is increased by RRE
15977068 GABARAP and DDX 47 are involved in the apoptotic process

AA Sequence

MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAET      1 - 70
GSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLALA     71 - 140
KKPHIIIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTK    141 - 210
KVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYIFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTA    211 - 280
LLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHR    281 - 350
VGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEK    351 - 420
KKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR                                       421 - 455
//

Text Mined References (30)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20941364 2010 Comparative structural analysis of human DEAD-box RNA helicases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...