Property Summary

NCBI Gene PubMed Count 48
PubMed Score 232.68
PubTator Score 101.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (33)

Disease log2 FC p
acute myeloid leukemia 1.100 9.9e-03
adult high grade glioma -2.200 1.1e-04
astrocytic glioma -1.300 2.3e-02
Astrocytoma, Pilocytic -1.100 6.1e-04
atypical teratoid / rhabdoid tumor -2.600 1.6e-08
Breast cancer -1.400 4.1e-10
breast carcinoma -1.600 1.9e-05
colon cancer -1.200 2.6e-02
dermatomyositis 1.500 3.3e-03
ductal carcinoma in situ -1.200 1.1e-03
Endometriosis -1.326 1.7e-02
ependymoma -1.600 3.5e-02
gastric cancer -1.100 2.0e-03
glioblastoma -1.500 1.4e-05
group 3 medulloblastoma -1.500 1.6e-03
hepatocellular carcinoma -1.100 8.7e-06
intraductal papillary-mucinous neoplasm ... -1.200 1.8e-02
invasive ductal carcinoma -1.600 6.5e-04
lung adenocarcinoma -1.100 8.0e-14
lung cancer -1.300 8.9e-05
medulloblastoma, large-cell -2.900 7.3e-06
mucosa-associated lymphoid tissue lympho... 1.441 2.9e-02
oligodendroglioma -1.400 3.5e-02
osteosarcoma -1.017 2.5e-03
ovarian cancer -1.100 7.2e-07
pancreatic cancer -1.300 1.1e-03
pancreatic carcinoma -1.300 1.1e-03
pituitary cancer -1.500 4.8e-04
primitive neuroectodermal tumor -1.800 9.7e-05
psoriasis -1.200 5.4e-06
subependymal giant cell astrocytoma -1.970 7.1e-03
tuberculosis -2.000 4.3e-06
urothelial carcinoma -1.200 1.3e-02

Gene RIF (17)

AA Sequence

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHL      1 - 70
RPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK                            71 - 117
//

Text Mined References (55)

PMID Year Title