Property Summary

NCBI Gene PubMed Count 47
PubMed Score 198.25
PubTator Score 101.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.08965525076508E-15
oligodendroglioma 2849 1.83637835954631E-14
lung adenocarcinoma 2714 8.15472341368752E-12
Breast cancer 3099 2.29061474830894E-10
psoriasis 6685 7.62182221597625E-10
pilocytic astrocytoma 3086 4.98795117577559E-9
atypical teratoid / rhabdoid tumor 4369 7.69229345073453E-9
ovarian cancer 8492 1.05949375260694E-7
sonic hedgehog group medulloblastoma 1482 2.87830236427494E-7
osteosarcoma 7933 3.32761411710803E-6
glioblastoma 5572 3.44043676723131E-6
tuberculosis 1563 4.25770604404222E-6
primitive neuroectodermal tumor 3031 7.56068381261351E-6
hepatocellular carcinoma 550 1.22049107670629E-5
medulloblastoma, large-cell 6234 1.72581756850591E-5
breast carcinoma 1614 1.90338162153805E-5
lung cancer 4473 8.85492980632127E-5
adult high grade glioma 2148 1.07999531302744E-4
pituitary cancer 1972 4.77559084353453E-4
ductal carcinoma in situ 1745 5.21771186286023E-4
pancreatic carcinoma 567 0.00111523810031665
pancreatic cancer 2300 0.00111523810031666
invasive ductal carcinoma 2950 0.00114280260286302
gastric cancer 436 0.00200771681567665
astrocytic glioma 2241 0.00265834859430458
dermatomyositis 967 0.00332089844387678
subependymal giant cell astrocytoma 2287 0.00710074647420197
acute myeloid leukemia 785 0.00988611916267658
urothelial carcinoma 318 0.012954456865331
Endometriosis 535 0.0168203865039399
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0180908087381271
colon cancer 1475 0.0260146276270096
mucosa-associated lymphoid tissue lymphoma 480 0.0292739085452612

Expression

  Differential Expression (33)

Disease log2 FC p
gastric cancer -1.100 0.002
hepatocellular carcinoma -1.300 0.000
pancreatic cancer -1.300 0.001
urothelial carcinoma -1.200 0.013
astrocytic glioma -1.800 0.003
posterior fossa group B ependymoma -2.600 0.000
oligodendroglioma -1.700 0.000
psoriasis -1.700 0.000
glioblastoma -2.100 0.000
osteosarcoma -2.452 0.000
sonic hedgehog group medulloblastoma -3.800 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -2.200 0.000
tuberculosis -2.000 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.018
colon cancer -1.200 0.026
lung cancer -1.300 0.000
breast carcinoma -1.600 0.000
lung adenocarcinoma -1.700 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.500 0.000
pancreatic carcinoma -1.300 0.001
subependymal giant cell astrocytoma -1.970 0.007
Endometriosis -1.326 0.017
Breast cancer -1.600 0.000
mucosa-associated lymphoid tissue lympho... 1.441 0.029
ductal carcinoma in situ -1.500 0.001
invasive ductal carcinoma -1.700 0.001
acute myeloid leukemia 1.100 0.010
ovarian cancer -3.200 0.000
pituitary cancer -1.500 0.000
dermatomyositis 1.500 0.003

Synonym

Accession Q9H0R8 B4E0Y7 Q6FIE6
Symbols ATG8
GEC1
APG8L
ATG8B
ATG8L
APG8-LIKE

Gene

PDB

2L8J   2R2Q  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (16)

PMID Text
26474850 Our data demonstrated that a specific decrease of GABARAPL1 expression in breast cancers was associated with both DNA methylation and histone deacetylation and that CREB-1 recruitment on GABARAPL1
26050226 Androgen deprivation downregulates Gabarapl1 in an AR dependent manner, resulting in the increase of autophagy flux
24879149 GABARAPL1 plays an important role in cell proliferation, invasion, and autophagic flux, as well as in mitochondrial homeostasis and cellular metabolic programs in a breast cancer cell line.
24747438 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24647565 Kaplan-Meier survival analysis showed a significant association between low GABARAPL1 expression and poor prognosis of HCC patients.
22959883 Results showed that the mRNA and protein levels of GABARAPL1 and GATE-16 were decreased in the cerebellum of multiple system atrophy relative to controls
22120110 Data demonstrate that HSP90 interacts and protects GABARAPL1 from its degradation by the proteasome.
21893048 Atg8 interacting motif (AIM) in Stbd1 is necessary for GABARAPL1 binding.
21620860 Results indicate that the presence of a tryptophan residue in the LIR motif increases the binding affinity of GABARAPL-1/NBR1-LIR complex.
21597319 analysis of specific functions of GABARAPL1 [review]
More...

AA Sequence

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHL      1 - 70
RPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK                            71 - 117
//

Text Mined References (54)

PMID Year Title
26474850 2015 The autophagy GABARAPL1 gene is epigenetically regulated in breast cancer models.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26050226 2015 Gabarapl1 mediates androgen-regulated autophagy in prostate cancer.
26040720 2015 Regulation of endoplasmic reticulum turnover by selective autophagy.
25416956 2014 A proteome-scale map of the human interactome network.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24879149 2014 The role of GABARAPL1/GEC1 in autophagic flux and mitochondrial quality control in MDA-MB-436 breast cancer cells.
24747438 2014 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24668264 2014 Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures.
24647565 2014 Low expression of GABARAPL1 is associated with a poor outcome for patients with hepatocellular carcinoma.
More...