Property Summary

NCBI Gene PubMed Count 47
Grant Count 64
R01 Count 47
Funding $8,059,361.61
PubMed Score 198.25
PubTator Score 101.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (33)

Disease log2 FC p
gastric cancer -1.100 0.002
hepatocellular carcinoma -1.300 0.000
pancreatic cancer -1.300 0.001
urothelial carcinoma -1.200 0.013
astrocytic glioma -1.800 0.003
posterior fossa group B ependymoma -2.600 0.000
oligodendroglioma -1.700 0.000
psoriasis -1.700 0.000
glioblastoma -2.100 0.000
osteosarcoma -2.452 0.000
sonic hedgehog group medulloblastoma -3.800 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -2.200 0.000
tuberculosis -2.000 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.018
colon cancer -1.200 0.026
lung cancer -1.300 0.000
breast carcinoma -1.600 0.000
lung adenocarcinoma -1.700 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.500 0.000
pancreatic carcinoma -1.300 0.001
subependymal giant cell astrocytoma -1.970 0.007
Endometriosis -1.326 0.017
Breast cancer -1.600 0.000
mucosa-associated lymphoid tissue lympho... 1.441 0.029
ductal carcinoma in situ -1.500 0.001
invasive ductal carcinoma -1.700 0.001
acute myeloid leukemia 1.100 0.010
ovarian cancer -3.200 0.000
pituitary cancer -1.500 0.000
dermatomyositis 1.500 0.003

Synonym

Accession Q9H0R8 B4E0Y7 Q6FIE6
Symbols ATG8
GEC1
APG8L
ATG8B
ATG8L
APG8-LIKE

Gene

PDB

2L8J   2R2Q  

Gene RIF (16)

PMID Text
26474850 Our data demonstrated that a specific decrease of GABARAPL1 expression in breast cancers was associated with both DNA methylation and histone deacetylation and that CREB-1 recruitment on GABARAPL1
26050226 Androgen deprivation downregulates Gabarapl1 in an AR dependent manner, resulting in the increase of autophagy flux
24879149 GABARAPL1 plays an important role in cell proliferation, invasion, and autophagic flux, as well as in mitochondrial homeostasis and cellular metabolic programs in a breast cancer cell line.
24747438 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24647565 Kaplan-Meier survival analysis showed a significant association between low GABARAPL1 expression and poor prognosis of HCC patients.
22959883 Results showed that the mRNA and protein levels of GABARAPL1 and GATE-16 were decreased in the cerebellum of multiple system atrophy relative to controls
22120110 Data demonstrate that HSP90 interacts and protects GABARAPL1 from its degradation by the proteasome.
21893048 Atg8 interacting motif (AIM) in Stbd1 is necessary for GABARAPL1 binding.
21620860 Results indicate that the presence of a tryptophan residue in the LIR motif increases the binding affinity of GABARAPL-1/NBR1-LIR complex.
21597319 analysis of specific functions of GABARAPL1 [review]
More...

AA Sequence

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHL      1 - 70
RPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK                            71 - 117
//

Text Mined References (54)

PMID Year Title
26474850 2015 The autophagy GABARAPL1 gene is epigenetically regulated in breast cancer models.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26050226 2015 Gabarapl1 mediates androgen-regulated autophagy in prostate cancer.
26040720 2015 Regulation of endoplasmic reticulum turnover by selective autophagy.
25416956 2014 A proteome-scale map of the human interactome network.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24879149 2014 The role of GABARAPL1/GEC1 in autophagic flux and mitochondrial quality control in MDA-MB-436 breast cancer cells.
24747438 2014 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24668264 2014 Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures.
24647565 2014 Low expression of GABARAPL1 is associated with a poor outcome for patients with hepatocellular carcinoma.
More...