Property Summary

NCBI Gene PubMed Count 8
PubMed Score 73.12
PubTator Score 361.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 3.0e-04
atypical teratoid / rhabdoid tumor 1.200 2.1e-03
group 3 medulloblastoma 1.200 4.6e-02
interstitial cystitis 1.100 7.1e-03
malignant mesothelioma 1.100 4.1e-06
medulloblastoma, large-cell 1.400 7.7e-03
osteosarcoma 1.383 1.5e-05
pituitary cancer 1.400 2.6e-04
primitive neuroectodermal tumor 1.200 4.1e-02

Gene RIF (3)

AA Sequence

MLGRSLREVSAALKQGQITPTELCQKCLSLIKKTKFLNAYITVSEEVALKQAEESEKRYKNGQSLGDLDG      1 - 70
IPIAVKDNFSTSGIETTCASNMLKGYIPPYNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVKN     71 - 140
PWSYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTGGSTRNPAAHCGLVGFKP    141 - 210
SYGLVSRHGLIPLVNSMDVPGILTRCVDDAAIVLGALAGPDPRDSTTVHEPINKPFMLPSLADVSKLCIG    211 - 280
IPKEYLVPELSSEVQSLWSKAADLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLQYGHR    281 - 350
CDIDVSTEAMYAATRREGFNDVVRGRILSGNFFLLKENYENYFVKAQKVRRLIANDFVNAFNSGVDVLLT    351 - 420
PTTLSEAVPYLEFIKEDNRTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGLPIGLQFIGRAFCDQQLLTV    421 - 490
AKWFEKQVQFPVIQLQELMDDCSAVLENEKLASVSLKQ                                    491 - 528
//

Text Mined References (12)

PMID Year Title