Property Summary

NCBI Gene PubMed Count 8
Grant Count 58
R01 Count 42
Funding $7,110,779.16
PubMed Score 74.94
PubTator Score 361.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma 1.383 0.000
medulloblastoma 1.400 0.001
atypical teratoid / rhabdoid tumor 1.200 0.002
medulloblastoma, large-cell 1.400 0.008
primitive neuroectodermal tumor 1.200 0.041
interstitial cystitis 1.100 0.007
pilocytic astrocytoma 1.300 0.000
pituitary cancer 1.400 0.000

Synonym

Accession Q9H0R6 Q5VWJ4 Q9HA60 Q9NV19 Glu-AdT subunit A
Symbols GatA

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19805282 Studies showed in vitro Gln-tRNA(Gln) formation catalyzed by the recombinant mtGluRS and hGatCAB.
18978678 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLGRSLREVSAALKQGQITPTELCQKCLSLIKKTKFLNAYITVSEEVALKQAEESEKRYKNGQSLGDLDG      1 - 70
IPIAVKDNFSTSGIETTCASNMLKGYIPPYNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVKN     71 - 140
PWSYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTGGSTRNPAAHCGLVGFKP    141 - 210
SYGLVSRHGLIPLVNSMDVPGILTRCVDDAAIVLGALAGPDPRDSTTVHEPINKPFMLPSLADVSKLCIG    211 - 280
IPKEYLVPELSSEVQSLWSKAADLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLQYGHR    281 - 350
CDIDVSTEAMYAATRREGFNDVVRGRILSGNFFLLKENYENYFVKAQKVRRLIANDFVNAFNSGVDVLLT    351 - 420
PTTLSEAVPYLEFIKEDNRTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGLPIGLQFIGRAFCDQQLLTV    421 - 490
AKWFEKQVQFPVIQLQELMDDCSAVLENEKLASVSLKQ                                    491 - 528
//

Text Mined References (12)

PMID Year Title
26741492 2016 A Comprehensive Genomic Analysis Reveals the Genetic Landscape of Mitochondrial Respiratory Chain Complex Deficiencies.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19805282 2009 Biogenesis of glutaminyl-mt tRNAGln in human mitochondria.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...