Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.3e-05
psoriasis 6694 7.2e-05
ovarian cancer 8520 7.3e-04

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.225 2.3e-05
ovarian cancer 1.100 7.3e-04
psoriasis 1.500 7.2e-05

Synonym

Accession Q9H0R3 D3DPL6 Q53HD8 Q5FVE9
Symbols C1orf160

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAEAEGSSLLLLPPPPPPPRMAEVEAPTAAETDMKQYQGSGGVAMDVERSRFPYCVVWTPIPVLTWFFPI      1 - 70
IGHMGICTSTGVIRDFAGPYFVSEDNMAFGKPAKYWKLDPAQVYASGPNAWDTAVHDASEEYKHRMHNLC     71 - 140
CDNCHSHVALALNLMRYNNSTNWNMVTLCFFCLLYGKYVSVGAFVKTWLPFILLLGIILTVSLVFNLR      141 - 208
//

Text Mined References (9)

PMID Year Title