Property Summary

NCBI Gene PubMed Count 10
PubMed Score 53.87
PubTator Score 11.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H0R1 O95354 Q6ZMD7 Q96DX3 Q9NVC5
Symbols Mu5
MuD
MUDENG
C14orf108

Gene

Gene RIF (2)

PMID Text
23665015 These results suggest that the adaptin domain plays a key role in MUDENG-mediated cell death.
18395520 The gene encoding the protein MUDENG (Mu-2 related death-inducing gene) was cloned and characterized.

AA Sequence

MAQRAVWLISHEPGTPLCGTVRFSRRYPTVEKRARVFNGASYVPVPEDGPFLKALLFELRLLDDDKDFVE      1 - 70
SRDSCSRINKTSIYGLLIGGEELWPVVAFLKNDMIYACVPLVEQTLSPRPPLISVSGVSQGFEFLFGIQD     71 - 140
FLYSGQKNDSELNTKLSQLPDLLLQACPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVS    141 - 210
ISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLSLPTNGSPLQDILVHPCVTSLDSAIL    211 - 280
TSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITINLKLHESVKNN    281 - 350
FEFCEAHIPFYNRGPITHLEYKTSFGQLEVFREKSLLIWIIGQKFPKSMEISLSGTVTFGAKSHEKQPFD    351 - 420
PICTGETAYLKLHFRILDYTLTGCYADQHSVQVFASGKPKISAHRKLISSDYYIWNSKAPAPVTYGSLLL    421 - 490
//

Text Mined References (10)

PMID Year Title
23665015 2013 MUDENG is cleaved by caspase-3 during TRAIL-induced cell death.
22022230 2011 The fifth adaptor protein complex.
18395520 2008 A novel protein, MUDENG, induces cell death in cytotoxic T cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.