Property Summary

NCBI Gene PubMed Count 22
PubMed Score 14.56
PubTator Score 15.70

Knowledge Summary

Patent (1,000)

TINX Plot

  Disease Sources (4)

Disease Target Count
Leukemia, Myelocytic, Acute 113
Disease Target Count P-value
psoriasis 6685 1.32949255473947E-73
lung adenocarcinoma 2714 5.79123493618661E-24
lung carcinoma 2844 3.96830737587718E-16
non-small cell lung cancer 2798 5.71401056182582E-15
colon cancer 1475 1.18969658482136E-7
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.69875432673913E-5
non-inflammatory breast cancer 208 1.43941286795626E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.72053943647587E-4
malignant mesothelioma 3163 6.04868011904726E-4
atypical teratoid / rhabdoid tumor 4369 6.58596715040289E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.0529549187546E-4
medulloblastoma, large-cell 6234 0.00279656078101771
Pick disease 1893 0.00886324109998028
lung cancer 4473 0.0138839370477816
Hydrolethalus syndrome 128 0.032715905752226
subependymal giant cell astrocytoma 2287 0.0330293739646147
invasive ductal carcinoma 2950 0.037723039935136
Disease Target Count Z-score Confidence
Schizophrenia 503 3.417 1.7
Disease Target Count
Schizophrenia 2 1

Expression

Synonym

Accession Q9H0Q3 A8K0R4 J3QLD2 Q6FIG9 Q6UW52
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (11)

PMID Text
26302771 FXYD6 was verified to be directly interacting with miR-137..
24715268 FXYD6 plays a critical role of in hepatocellular carcinoma disease progression.
21983730 FXYD6 gene might play an important role in schizophrenia susceptibility.
21216238 these results support that FXYD6 is a susceptibility gene of schizophrenia.
20468077 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20149392 Data show that FXYD6 does not play a role in schizophrenia in the Chinese Han population.
20149392 Observational study of gene-disease association. (HuGE Navigator)
18455306 Our findings suggest that FXYD6 is unlikely to be related to the development of schizophrenia in a Japanese population.
18455306 Observational study of gene-disease association. (HuGE Navigator)
17357072 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR      1 - 70
APGDEEAQVENLITANATEPQKAEN                                                  71 - 95
//

Text Mined References (25)

PMID Year Title
26302771 2016 MicroRNA-137 is downregulated in human osteosarcoma and regulates cell proliferation and migration through targeting FXYD6.
25416956 2014 A proteome-scale map of the human interactome network.
24715268 2014 FXYD6: a novel therapeutic target toward hepatocellular carcinoma.
21983730 2011 [A family-based association study of FXYD6 gene polymorphisms and schizophrenia].
21216238 2011 A novel replicated association between FXYD6 gene and schizophrenia.
20468077 2010 Failure to confirm genetic association of the FXYD6 gene with schizophrenia: the Japanese population and meta-analysis.
20149392 2010 No association between the FXYD6 gene and schizophrenia in the Chinese Han population.
18455306 2008 A genetic association study of the FXYD domain containing ion transport regulator 6 (FXYD6) gene, encoding phosphohippolin, in susceptibility to schizophrenia in a Japanese population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17357072 2007 A genetic association study of chromosome 11q22-24 in two different samples implicates the FXYD6 gene, encoding phosphohippolin, in susceptibility to schizophrenia.
More...