Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.05
PubTator Score 15.70

Knowledge Summary

Patent (1,000)

Expression

  Differential Expression (17)

Gene RIF (11)

AA Sequence

MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR      1 - 70
APGDEEAQVENLITANATEPQKAEN                                                  71 - 95
//

Text Mined References (25)

PMID Year Title