Property Summary

NCBI Gene PubMed Count 22
Grant Count 3
R01 Count 3
Funding $373,700
PubMed Score 14.56
PubTator Score 15.70

Knowledge Summary

Patent (1,000)

Expression

Gene RIF (11)

PMID Text
26302771 FXYD6 was verified to be directly interacting with miR-137..
24715268 FXYD6 plays a critical role of in hepatocellular carcinoma disease progression.
21983730 FXYD6 gene might play an important role in schizophrenia susceptibility.
21216238 these results support that FXYD6 is a susceptibility gene of schizophrenia.
20468077 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20149392 Data show that FXYD6 does not play a role in schizophrenia in the Chinese Han population.
20149392 Observational study of gene-disease association. (HuGE Navigator)
18455306 Our findings suggest that FXYD6 is unlikely to be related to the development of schizophrenia in a Japanese population.
18455306 Observational study of gene-disease association. (HuGE Navigator)
17357072 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR      1 - 70
APGDEEAQVENLITANATEPQKAEN                                                  71 - 95
//

Text Mined References (25)

PMID Year Title
26302771 2016 MicroRNA-137 is downregulated in human osteosarcoma and regulates cell proliferation and migration through targeting FXYD6.
25416956 2014 A proteome-scale map of the human interactome network.
24715268 2014 FXYD6: a novel therapeutic target toward hepatocellular carcinoma.
21983730 2011 [A family-based association study of FXYD6 gene polymorphisms and schizophrenia].
21216238 2011 A novel replicated association between FXYD6 gene and schizophrenia.
20468077 2010 Failure to confirm genetic association of the FXYD6 gene with schizophrenia: the Japanese population and meta-analysis.
20149392 2010 No association between the FXYD6 gene and schizophrenia in the Chinese Han population.
18455306 2008 A genetic association study of the FXYD domain containing ion transport regulator 6 (FXYD6) gene, encoding phosphohippolin, in susceptibility to schizophrenia in a Japanese population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17357072 2007 A genetic association study of chromosome 11q22-24 in two different samples implicates the FXYD6 gene, encoding phosphohippolin, in susceptibility to schizophrenia.
More...