Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
astrocytic glioma -2.000 0.003
ependymoma -2.100 0.006
oligodendroglioma -1.500 0.018
cutaneous lupus erythematosus 2.100 0.004
glioblastoma -2.100 0.000
osteosarcoma -1.364 0.000
medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -4.300 0.000
medulloblastoma, large-cell -4.700 0.000
primitive neuroectodermal tumor -1.400 0.010
adrenocortical carcinoma -1.310 0.026
non-small cell lung cancer -1.608 0.000
lung cancer -4.300 0.000
diabetes mellitus -1.100 0.005
interstitial cystitis 1.100 0.005
cystic fibrosis -3.800 0.000
adult high grade glioma -1.500 0.002
lung carcinoma -1.500 0.000
Pick disease -1.300 0.000
Breast cancer -1.500 0.000
gastric carcinoma 1.300 0.034
mucosa-associated lymphoid tissue lympho... 1.785 0.029
invasive ductal carcinoma -1.800 0.000
ulcerative colitis 1.800 0.001
pituitary cancer -2.900 0.000

Synonym

Accession Q9H0Q0 B3KNZ1 Q53QW2
Symbols

Gene

Gene RIF (1)

PMID Text
23333304 HIV-1 Vif upregulates the expression of family with sequence similarity 49, member A (FAM49A) in Vif-expression T cells

AA Sequence

MGNLLKVLTREIENYPHFFLDFENAQPTEGEREIWNQISAVLQDSESILADLQAYKGAGPEIRDAIQNPN      1 - 70
DIQLQEKAWNAVCPLVVRLKRFYEFSIRLEKALQSLLESLTCPPYTPTQHLEREQALAKEFAEILHFTLR     71 - 140
FDELKMRNPAIQNDFSYYRRTISRNRINNMHLDIENEVNNEMANRMSLFYAEATPMLKTLSNATMHFVSE    141 - 210
NKTLPIENTTDCLSTMTSVCKVMLETPEYRSRFTSEETLMFCMRVMVGVIILYDHVHPVGAFCKTSKIDM    211 - 280
KGCIKVLKEQAPDSVEGLLNALRFTTKHLNDESTSKQIRAMLQ                               281 - 323
//

Text Mined References (13)

PMID Year Title
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...