Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis 2010 2.2e-04
osteosarcoma 7950 1.1e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.084 1.1e-03
tuberculosis -1.500 2.2e-04

Synonym

Accession Q9H0P7 A7E1X1 Q2M1M7 Q5TEF2 Q9H5S5
Symbols C6orf59
NCRNA00241

 Compartment GO Term (0)

AA Sequence

MADTQCCPPPCEFISSAGTDLALGMGWDATLCLLPFTGFGKCAGIWNHMDEEPDNGDDRGSRRTTGQGRK      1 - 70
WAAHGTMAAPRVHTDYHPGGGSACSSVKVRSHVGHTGVFFFVDQDPLAVSLTSQSLIPPLIKPGLLKAWG     71 - 140
FLLLCAQPSANGHSLCCLLYTDLVSSHELSPFRALCLGPSDAPSACASCNCLASTYYL                141 - 198
//

Text Mined References (5)

PMID Year Title