Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.33
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 6.90545549244477E-8
ovarian cancer 8492 4.84716081255125E-7
osteosarcoma 7933 2.16310002154181E-6
cystic fibrosis 1670 1.36678808904853E-5
tuberculosis 1563 1.1409585186136E-4
Disease Target Count Z-score Confidence
maturity-onset diabetes of the young 30 3.508 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.435 0.000
tuberculosis 1.100 0.000
cystic fibrosis -1.300 0.000
posterior fossa group B ependymoma 1.400 0.000
ovarian cancer -1.400 0.000

Synonym

Accession Q9H0N5 Q8TD40 PHS 2
Symbols PHS2
DCOH2
DCOHM

Gene

PANTHER Protein Class (2)

PDB

4C45  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
12646162 PMID: 12646162 concludes Alu repeats interfere with splicing of DCOHM and CAVL such that transcripts containing exons of both genes exist.

AA Sequence

MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNF      1 - 70
NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV               71 - 130
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23568457 2013 Genetic variants associated with disordered eating.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15546961 2005 Novel interaction partners of the TPR/MET tyrosine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...