Property Summary

NCBI Gene PubMed Count 16
Grant Count 2
Funding $652,291.77
PubMed Score 3.33
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.435 0.000
tuberculosis 1.100 0.000
cystic fibrosis -1.300 0.000
posterior fossa group B ependymoma 1.400 0.000
ovarian cancer -1.400 0.000

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
12646162 PMID: 12646162 concludes Alu repeats interfere with splicing of DCOHM and CAVL such that transcripts containing exons of both genes exist.

AA Sequence

MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNF      1 - 70
NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV               71 - 130
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23568457 2013 Genetic variants associated with disordered eating.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15546961 2005 Novel interaction partners of the TPR/MET tyrosine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...