Property Summary

NCBI Gene PubMed Count 16
Grant Count 3
R01 Count 3
Funding $107,231.49
PubMed Score 8.37
PubTator Score 8.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 0.000

Synonym

Accession Q9H0N0 Q53RU3 Q6FIF7 Q9P128
Symbols WTH3

Gene

Gene RIF (8)

PMID Text
22949199 Rab6A'(Q72L) was then purified to homogeneity and crystallized at 293 K. X-ray diffraction data were collected to a resolution of 1.9 A from a crystal belonging to space group P22(1)2(1) with unit-cell parameters a = 36.84, b = 96.78, c = 109.99 A
20198315 Observational study of gene-disease association. (HuGE Navigator)
20064528 RAB6C is a rare example of a recently emerged retrogene that has acquired the status of a new gene, encoding a functional protein with altered characteristics compared to Rab6A'.
19851296 Observational study of gene-disease association. (HuGE Navigator)
18992151 plays role in multi-drug resistance development;DNA methylation is one of its transcription regulatory mechanisms
18187620 Knockdown of RAB6C, member RAS oncogene family by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17426708 The negative role played by the WTH3 gene in MDR development is through its proapoptotic potential that is regulated by multiple mechanisms at the transcription level, and one of these mechanisms is linked to the p53 gene.
16267028 The behavior of WTH3 in primary drug-resistant breast cancer epithelial cells was similar to that in a model system where epigenetic regulation of the WTH3 gene was linked to the MDR phenotype.

AA Sequence

MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDGTIGLRLWDTA      1 - 70
GQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIITLVGNRTDLADKRQVSVEE     71 - 140
GERKAKGLNVTFIETRAKAGYNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYS    141 - 210
PMSSSTLPQKPPYSFIDCSVNIGLNLFPSLITFCNSSLLPVSWR                              211 - 254
//

Text Mined References (19)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
22949199 2012 Crystallization and preliminary X-ray crystallographic studies of Rab6A'(Q72L): a GTP-locked form.
21822290 2011 Modulation of Rab GTPase function by a protein phosphocholine transferase.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20064528 2010 RAB6C is a retrogene that encodes a centrosomal protein involved in cell cycle progression.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18992151 2008 Methylation of WTH3, a possible drug resistant gene, inhibits p53 regulated expression.
17426708 2007 WTH3 is a direct target of the p53 protein.
16267028 2005 Epigenetic regulation of WTH3 in primary and cultured drug-resistant breast cancer cells.
16103095 2005 WTH3, which encodes a small G protein, is differentially regulated in multidrug-resistant and sensitive MCF7 cells.
More...