Property Summary

NCBI Gene PubMed Count 54
Grant Count 35
R01 Count 27
Funding $3,021,969.1
PubMed Score 42.80
PubTator Score 42.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma 2.734 0.000
active Crohn's disease 1.193 0.022
group 3 medulloblastoma -1.100 0.007
Pick disease 1.300 0.000
ovarian cancer 1.400 0.002

Gene RIF (38)

PMID Text
26506518 Overexpression of WWP1 promotes tumorigenesis in patients with hepatocellular carcinoma.
26152726 The cancer-driven alteration of WWP1 culminates in excessive TbetaRI degradation and attenuated TGFbeta1 cytostatic signaling, a consequence that could conceivably confer tumorigenic properties to WWP1.
25814387 PTPN14, a Pez mammalian homolog, is degraded by overexpressed Su(dx) or Su(dx) homologue WWP1 in mammalian cells.
25755729 miR-21 overexpression or WWP1 knockdown in endothelial progenitor cells significantly activates the TGFbeta signaling pathway and inhibits cell proliferation.
25293520 Most notably, WWP1 downregulation both inactivated PTEN-Akt signaling pathway in MKN-45 and AGS cells. our findings suggest that WWP1 acts as an oncogenic factor and should be considered as a novel interfering molecular target for gastric carcinoma
25071155 Data show that WWP1, which specifically ubiquitinates and degrades DeltaNp73 heterodimerizes with another E3 ligase, WWP2.
25051198 Results suggest that elevated transcription and expression levels of ubiquitin ligase E3s WWP1, Smurf1 and Smurf2 genes may be the mechanisms of occurrence, development and metastasis of prostate cancer.
24792179 Knocking down WWP1 promoted cleaved caspase3 protein and p53 expression in hepatocellular carcinoma cells, and caspase3 inhibition could prevent cell apoptosis induced by the knockdown of WWP1.
23849376 results reveal that WWP1 might play an oncogenic role in oral cancer cells.
23573293 LATS1 is critical in mediating WWP1-induced increased cell proliferation in breast cancer cells.
More...

AA Sequence

MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEITKTAKSSSSSNPKWDEQLTV      1 - 70
NVTPQTTLEFQVWSHRTLKADALLGKATIDLKQALLIHNRKLERVKEQLKLSLENKNGIAQTGELTVVLD     71 - 140
GLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNG    141 - 210
DNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGTPVVSEENALSPNCTSTTVED    211 - 280
PPVQEILTSSENNECIPSTSAELESEARSILEPDTSNSRSSSAFEAAKSRQPDGCMDPVRQQSGNANTET    281 - 350
LPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNF    351 - 420
EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQ    421 - 490
GLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERGFRWKLAHFRYLCQS    491 - 560
NALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCL    561 - 630
FEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESID    631 - 700
TEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQ    701 - 770
EQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN    771 - 840
EVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLL    841 - 910
FAIEETEGFGQE                                                              911 - 922
//

Text Mined References (56)

PMID Year Title
26506518 2015 Overexpression of WWP1 promotes tumorigenesis and predicts unfavorable prognosis in patients with hepatocellular carcinoma.
26152726 2015 Functional Characterization of a WWP1/Tiul1 Tumor-derived Mutant Reveals a Paradigm of Its Constitutive Activation in Human Cancer.
25814387 2015 Suppressor of Deltex mediates Pez degradation and modulates Drosophila midgut homeostasis.
25755729 2015 MiR-21 suppresses endothelial progenitor cell proliferation by activating the TGF? signaling pathway via downregulation of WWP1.
25416956 2014 A proteome-scale map of the human interactome network.
25293520 2015 WWP1 as a potential tumor oncogene regulates PTEN-Akt signaling pathway in human gastric carcinoma.
25071155 2014 WWP2-WWP1 ubiquitin ligase complex coordinated by PPM1G maintains the balance between cellular p73 and ?Np73 levels.
25051198 2014 Bortezomib prevents oncogenesis and bone metastasis of prostate cancer by inhibiting WWP1, Smurf1 and Smurf2.
24792179 2014 Knockdown of WWP1 inhibits growth and induces apoptosis in hepatoma carcinoma cells through the activation of caspase3 and p53.
23849376 2013 WWP1 gene is a potential molecular target of human oral cancer.
More...