Property Summary

NCBI Gene PubMed Count 60
PubMed Score 49.00
PubTator Score 42.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.1e-08
osteosarcoma 7950 8.4e-07
Pick disease 1894 1.1e-05
ovarian cancer 8520 1.5e-03
group 3 medulloblastoma 4104 6.8e-03
active Crohn's disease 922 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease 1.193 2.2e-02
group 3 medulloblastoma -1.100 6.8e-03
osteosarcoma 2.734 8.4e-07
ovarian cancer -1.100 1.5e-03
Pick disease 1.300 1.1e-05
psoriasis -1.300 1.1e-08

Protein-protein Interaction (3)

Gene RIF (43)

AA Sequence

MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEITKTAKSSSSSNPKWDEQLTV      1 - 70
NVTPQTTLEFQVWSHRTLKADALLGKATIDLKQALLIHNRKLERVKEQLKLSLENKNGIAQTGELTVVLD     71 - 140
GLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNG    141 - 210
DNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGTPVVSEENALSPNCTSTTVED    211 - 280
PPVQEILTSSENNECIPSTSAELESEARSILEPDTSNSRSSSAFEAAKSRQPDGCMDPVRQQSGNANTET    281 - 350
LPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNF    351 - 420
EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQ    421 - 490
GLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERGFRWKLAHFRYLCQS    491 - 560
NALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCL    561 - 630
FEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESID    631 - 700
TEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQ    701 - 770
EQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN    771 - 840
EVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLL    841 - 910
FAIEETEGFGQE                                                              911 - 922
//

Text Mined References (62)

PMID Year Title