Property Summary

NCBI Gene PubMed Count 22
Grant Count 11
R01 Count 11
Funding $1,262,758.83
PubMed Score 8.94
PubTator Score 2.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
interstitial lung disease -1.200 0.022
sarcoidosis 1.200 0.011
Pneumonia 1.300 0.011
ovarian cancer -1.900 0.000

Gene RIF (6)

PMID Text
24149845 CstF64 and CstF64tau modulate one another's expression and play overlapping as well as distinct roles in regulating global alternative polyadenylation profiles.
19779565 Studied expression levels of CstF-64 in EV71-infected cells; showed reduction of CstF-64 during virus infection correlated with production of viral 3C(pro). CstF-64 was cleaved in vitro by 3C(pro) not by mutant 3C(pro) variants.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15767428 upstream element in human papillomavirus type 16 interacted specifically with CstF-64, hnRNP C1/C2 & polypyrimidine tract binding protein, suggesting these factors were enhancing or regulating polyadenylation at the HPV-16 early polyadenylation signal
12773396 structure of the RNA-binding domain of CstF-64 containing an RNA recognition motif (RRM) augmented by N- and C-terminal helices
12408968 Radiation hybrid mapping places the human tauCstF-64 gene at 10q22-q23, which is the site of a translocation that has been associated with human neurological problems and male infertility.

AA Sequence

MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETA      1 - 70
LSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPIIDSPYGDPIDPEDAPESITRAVASLPPEQM     71 - 140
FELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHRKIHVTPLIPGKSQSVSV    141 - 210
SGPGPGPGPGLCPGPNVLLNQQNPPAPQPQHLARRPVKDIPPLMQTPIQGGIPAPGPIPAAVPGAGPGSL    211 - 280
TPGGAMQPQLGMPGVGPVPLERGQVQMSDPRAPIPRGPVTPGGLPPRGLLGDAPNDPRGGTLLSVTGEVE    281 - 350
PRGYLGPPHQGPPMHHASGHDTRGPSSHEMRGGPLGDPRLLIGEPRGPMIDQRGLPMDGRGGRDSRAMET    351 - 420
RAMETEVLETRVMERRGMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGPINIGAGGPPQ    421 - 490
GPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPS    491 - 560
SFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS                  561 - 616
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
24149845 2013 Overlapping and distinct functions of CstF64 and CstF64? in mammalian mRNA 3' processing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19779565 2009 Enterovirus 71 3C protease cleaves a novel target CstF-64 and inhibits cellular polyadenylation.
More...