Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.94
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 6.2e-07
hepatocellular carcinoma 547 2.0e-06
Pneumonia 174 1.1e-02
sarcoidosis 370 1.1e-02
interstitial lung disease 298 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Male infertility 206 3.638 1.8
Infertility 188 3.19 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.100 2.0e-06
interstitial lung disease -1.200 2.2e-02
ovarian cancer -1.900 6.2e-07
Pneumonia 1.300 1.1e-02
sarcoidosis 1.200 1.1e-02

Protein-protein Interaction (6)

Gene RIF (7)

AA Sequence

MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETA      1 - 70
LSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPIIDSPYGDPIDPEDAPESITRAVASLPPEQM     71 - 140
FELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHRKIHVTPLIPGKSQSVSV    141 - 210
SGPGPGPGPGLCPGPNVLLNQQNPPAPQPQHLARRPVKDIPPLMQTPIQGGIPAPGPIPAAVPGAGPGSL    211 - 280
TPGGAMQPQLGMPGVGPVPLERGQVQMSDPRAPIPRGPVTPGGLPPRGLLGDAPNDPRGGTLLSVTGEVE    281 - 350
PRGYLGPPHQGPPMHHASGHDTRGPSSHEMRGGPLGDPRLLIGEPRGPMIDQRGLPMDGRGGRDSRAMET    351 - 420
RAMETEVLETRVMERRGMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGPINIGAGGPPQ    421 - 490
GPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPS    491 - 560
SFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS                  561 - 616
//

Text Mined References (29)

PMID Year Title