Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.55374350590607E-17
ependymoma 2514 1.02342319968971E-9
glioblastoma 5572 5.3825917044153E-9
atypical teratoid / rhabdoid tumor 4369 6.05394203911994E-8
medulloblastoma 1524 7.25654679969068E-7
pilocytic astrocytoma 3086 8.09486057415808E-7
hepatocellular carcinoma 550 2.01355436938423E-6
medulloblastoma, large-cell 6234 1.41420697709725E-5
primitive neuroectodermal tumor 3031 3.11814255091955E-5
Pick disease 1893 3.76998411436897E-5
ovarian cancer 8492 9.32159676194312E-5
gastric cancer 436 3.49183311506926E-4
lung cancer 4473 0.00257879017763057
pancreatic carcinoma 567 0.00303356534178117
pancreatic cancer 2300 0.0030335653417812
progressive supranuclear palsy 674 0.00695849975943405
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0106506814813941
intraductal papillary-mucinous adenoma (IPMA) 2956 0.011200475173954

Expression

  Differential Expression (18)

Synonym

Accession Q9H0K6 B3KUJ1 Q05CU0 Q6AHZ3 Q6NUP2
Symbols

Gene

  Ortholog (10)

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEEDTDYRIRFSSLCFFNDHVGFHGTIKSSPSDFIVIEIDEQGQLVNKTIDEPIFKISEIQLEPNNFPKK      1 - 70
PKLDLQNLSLEDGRNQEVHTLIKYTDGDQNHQSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNF     71 - 140
ACDVREKWLSKTELIGLPPEFSIGRILDKNQRASLHSAIRQKFPFLVTVGKNSEIVVKPNLEYKELCHLV    141 - 210
SEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRF    211 - 280
REKAHKRGKRPLSECQEGKVIYTAFTLRKENLEMFEAIGFLAIKLGVIPSDFSYAGLKDKKAITYQAMVV    281 - 350
RKVTPERLKNIEKEIEKKRMNVFNIRSVDDSLRLGQLKGNHFDIVIRNLKKQINDSANLRERIMEAIENV    351 - 420
KKKGFVNYYGPQRFGKGRKVHTDQIGLALLKNEMMKAIKLFLTPEDLDDPVNRAKKYFLQTEDAKGTLSL    421 - 490
MPEFKVRERALLEALHRFGMTEEGCIQAWFSLPHSMRIFYVHAYTSKIWNEAVSYRLETYGARVVQGDLV    491 - 560
CLDEDIDDENFPNSKIHLVTEEEGSANMYAIHQVVLPVLGYNIQYPKNKVGQWYHDILSRDGLQTCRFKV    561 - 630
PTLKLNIPGCYRQILKHPCNLSYQLMEDHDIDVKTKGSHIDETALSLLISFDLDASCYATVCLKEIMKHD    631 - 700
V//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
More...