Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 5.8e-07
atypical teratoid / rhabdoid tumor 1.300 6.1e-08
ependymoma 1.200 1.0e-09
gastric cancer 1.400 3.5e-04
glioblastoma 1.300 5.4e-09
group 3 medulloblastoma 1.700 7.2e-04
hepatocellular carcinoma 1.100 2.0e-06
intraductal papillary-mucinous adenoma (... 1.200 1.1e-02
intraductal papillary-mucinous carcinoma... 1.300 1.1e-02
lung cancer 1.300 2.6e-03
lung carcinoma 1.100 2.6e-17
medulloblastoma, large-cell 1.900 1.4e-05
ovarian cancer 1.800 9.3e-05
pancreatic cancer 1.100 3.0e-03
pancreatic carcinoma 1.100 3.0e-03
Pick disease -1.200 3.8e-05
primitive neuroectodermal tumor 1.400 3.1e-05
progressive supranuclear palsy -1.300 7.0e-03

Gene RIF (4)

AA Sequence

MEEDTDYRIRFSSLCFFNDHVGFHGTIKSSPSDFIVIEIDEQGQLVNKTIDEPIFKISEIQLEPNNFPKK      1 - 70
PKLDLQNLSLEDGRNQEVHTLIKYTDGDQNHQSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNF     71 - 140
ACDVREKWLSKTELIGLPPEFSIGRILDKNQRASLHSAIRQKFPFLVTVGKNSEIVVKPNLEYKELCHLV    141 - 210
SEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRF    211 - 280
REKAHKRGKRPLSECQEGKVIYTAFTLRKENLEMFEAIGFLAIKLGVIPSDFSYAGLKDKKAITYQAMVV    281 - 350
RKVTPERLKNIEKEIEKKRMNVFNIRSVDDSLRLGQLKGNHFDIVIRNLKKQINDSANLRERIMEAIENV    351 - 420
KKKGFVNYYGPQRFGKGRKVHTDQIGLALLKNEMMKAIKLFLTPEDLDDPVNRAKKYFLQTEDAKGTLSL    421 - 490
MPEFKVRERALLEALHRFGMTEEGCIQAWFSLPHSMRIFYVHAYTSKIWNEAVSYRLETYGARVVQGDLV    491 - 560
CLDEDIDDENFPNSKIHLVTEEEGSANMYAIHQVVLPVLGYNIQYPKNKVGQWYHDILSRDGLQTCRFKV    561 - 630
PTLKLNIPGCYRQILKHPCNLSYQLMEDHDIDVKTKGSHIDETALSLLISFDLDASCYATVCLKEIMKHD    631 - 700
V//

Text Mined References (19)

PMID Year Title