Property Summary

NCBI Gene PubMed Count 27
Grant Count 18
R01 Count 8
Funding $1,079,625.78
PubMed Score 33.24
PubTator Score 17.80

Knowledge Summary

Patent (5,126)

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.147 0.006
tuberculosis and treatment for 3 months -1.100 0.000
intraductal papillary-mucinous neoplasm ... -1.800 0.001
lung cancer -1.200 0.001
psoriasis -1.300 0.000
breast carcinoma -1.100 0.000
Breast cancer -1.200 0.000
ductal carcinoma in situ -2.400 0.000
invasive ductal carcinoma -2.900 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (10)

PMID Text
25548099 Examination of SIK2 in prostate cancer cells found that it functions both as a positive regulator of cell-cycle progression and a negative regulator of CREB1 activity. Also, the study shows high levels of auto-antibodies against SIK2 in plasma.
24841198 this study suggests that the tightly linked regulatory loop comprised of the SIK2-PP2A and CaMKI and PME-1 networks may function in fine-tuning cell proliferation and stress response.
24129571 a mechanism by which the interplay between SIK2 and p97/VCP contributes to the regulation of ERAD in mammalian cells.
23577667 These findings revealed a new function of LKB1 and salt-inducible kinases as negative regulators of HTLV-1 transcription.
23393134 tumor suppressor kinase LKB1 activates the downstream kinases SIK2 and SIK3 to stimulate nuclear export of class IIa histone deacetylases
23322770 findings uncover SIK2 as a critical determinant in autophagy progression and further suggest a mechanism in which the interplay among kinase and deacetylase activities contributes to cellular protein pool homeostasis.
22462548 In adipocytes, Ser358 (not Ser587) is the main site phosphorylated and responsible for the binding of SIK2 to 14-3-3 proteins.
20708153 Depletion of SIK2 also delayed G1/S transition and reduced AKT phosphorylation. Higher expression of SIK2 significantly correlated with poor survival in patients with high-grade serous ovarian cancers
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20367563 Increased SIK2 expression is associated with diffuse large B-cell lymphoma.

AA Sequence

MVMADGPRHLQRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQI      1 - 70
MKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKIVH     71 - 140
RDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVL    141 - 210
VCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLTIAQIKEHKWMLIEVPVQRP    211 - 280
VLYPQEQENEPSIGEFNEQVLRLMHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRL    281 - 350
DGRQRRPSTIAEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFSFPASGCQAEAAFMEEECVDT    351 - 420
PKVNGCLLDPVPPVLVRKGCQSLPSNMMETSIDEGLETEGEAEEDPAHAFEAFQSTRSGQRRHTLSEVTN    421 - 490
QLVVMPGAGKIFSMNDSPSLDSVDSEYDMGSVQRDLNFLEDNPSLKDIMLANQPSPRMTSPFISLRPTNP    491 - 560
AMQALSSQKREVHNRSPVSFREGRRASDTSLTQGIVAFRQHLQNLARTKGILELNKVQLLYEQIGPEADP    561 - 630
NLAPAAPQLQDLASSCPQEEVSQQQESVSTLPASVHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLY    631 - 700
CKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQIAESSYPQPSQQLPLPRQETPPPSQQAPPFSL    701 - 770
TQPLSPVLEPSSEQMQYSPFLSQYQEMQLQPLPSTSGPRAAPPLPTQLQQQQPPPPPPPPPPRQPGAAPA    771 - 840
PLQFSYQTCELPSAASPAPDYPTPCQYPVDGAQQSDLTGPDCPRSPGLQEAPSSYDPLALSELPGLFDCE    841 - 910
MLDAVDPQHNGYVLVN                                                          911 - 926
//

Text Mined References (33)

PMID Year Title
25548099 2015 Salt-inducible kinase 2 regulates mitotic progression and transcription in prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24841198 2014 Interaction between salt-inducible kinase 2 and protein phosphatase 2A regulates the activity of calcium/calmodulin-dependent protein kinase I and protein phosphatase methylesterase-1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129571 2013 Interaction between salt-inducible kinase 2 (SIK2) and p97/valosin-containing protein (VCP) regulates endoplasmic reticulum (ER)-associated protein degradation in mammalian cells.
23577667 2013 LKB1 tumor suppressor and salt-inducible kinases negatively regulate human T-cell leukemia virus type 1 transcription.
23393134 2013 The tumor suppressor kinase LKB1 activates the downstream kinases SIK2 and SIK3 to stimulate nuclear export of class IIa histone deacetylases.
23322770 2013 Reversible acetylation regulates salt-inducible kinase (SIK2) and its function in autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22462548 2012 The AMPK-related kinase SIK2 is regulated by cAMP via phosphorylation at Ser358 in adipocytes.
More...