Property Summary

Ligand Count 11
NCBI Gene PubMed Count 33
PubMed Score 36.53
PubTator Score 17.80

Knowledge Summary

Patent (5,126)

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -1.200 3.1e-11
breast carcinoma -1.100 1.3e-26
ductal carcinoma in situ -1.400 1.9e-03
intraductal papillary-mucinous neoplasm ... -1.800 1.4e-03
invasive ductal carcinoma -1.400 1.1e-02
lung cancer -1.200 6.0e-04
osteosarcoma -1.147 6.4e-03
psoriasis -1.300 4.2e-12
tuberculosis and treatment for 3 months -1.100 7.4e-06

 IMPC Phenotype (1)

Gene RIF (16)

AA Sequence

MVMADGPRHLQRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQI      1 - 70
MKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKIVH     71 - 140
RDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVL    141 - 210
VCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLTIAQIKEHKWMLIEVPVQRP    211 - 280
VLYPQEQENEPSIGEFNEQVLRLMHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRL    281 - 350
DGRQRRPSTIAEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFSFPASGCQAEAAFMEEECVDT    351 - 420
PKVNGCLLDPVPPVLVRKGCQSLPSNMMETSIDEGLETEGEAEEDPAHAFEAFQSTRSGQRRHTLSEVTN    421 - 490
QLVVMPGAGKIFSMNDSPSLDSVDSEYDMGSVQRDLNFLEDNPSLKDIMLANQPSPRMTSPFISLRPTNP    491 - 560
AMQALSSQKREVHNRSPVSFREGRRASDTSLTQGIVAFRQHLQNLARTKGILELNKVQLLYEQIGPEADP    561 - 630
NLAPAAPQLQDLASSCPQEEVSQQQESVSTLPASVHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLY    631 - 700
CKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQIAESSYPQPSQQLPLPRQETPPPSQQAPPFSL    701 - 770
TQPLSPVLEPSSEQMQYSPFLSQYQEMQLQPLPSTSGPRAAPPLPTQLQQQQPPPPPPPPPPRQPGAAPA    771 - 840
PLQFSYQTCELPSAASPAPDYPTPCQYPVDGAQQSDLTGPDCPRSPGLQEAPSSYDPLALSELPGLFDCE    841 - 910
MLDAVDPQHNGYVLVN                                                          911 - 926
//

Text Mined References (39)

PMID Year Title