Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.22
PubTator Score 0.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 9.7e-03
Astrocytoma, Pilocytic -1.200 1.8e-03
atypical teratoid / rhabdoid tumor -1.500 1.7e-02
ependymoma 1.200 3.1e-03
glioblastoma -2.000 6.6e-04
group 3 medulloblastoma -1.600 1.7e-02
interstitial cystitis -1.800 1.6e-03
medulloblastoma, large-cell -2.900 1.6e-04
nasopharyngeal carcinoma -3.100 2.2e-05
osteosarcoma -1.210 3.5e-02
ovarian cancer 1.400 5.5e-03

AA Sequence

MTDDESESVLSDSHEGSELELPVIQLCGLVEELSYVNSALKTETEMFEKYYAKLEPRDQRPPRLSEIKIS      1 - 70
AADYAQFRGRRRSKSRTGMDRGVGLTADQKLELVQKEVADMKDDLRHTRANAERDLQHHEAIIEEAEIRW     71 - 140
SEVSREVHEFEKDILKAISKKKGSILATQKVMKYIEDMNRRRDNMKEKLRLKNVSLKVQRKKMLLQLRQK    141 - 210
EEVSEALHDVDFQQLKIENAQFLETIEARNQELTQLKLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILL    211 - 280
RKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKVEIAEM    281 - 350
SLKGHRKAWNRMKITNEQLQADYLAGK                                               351 - 377
//

Text Mined References (12)

PMID Year Title