Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.22
PubTator Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.9715817281939E-8
nasopharyngeal carcinoma 1056 2.15266535341385E-5
medulloblastoma, large-cell 6234 1.64669145366623E-4
glioblastoma 5572 6.55165795021564E-4
pediatric high grade glioma 2712 9.37670986324521E-4
interstitial cystitis 2299 0.00158741947811802
pilocytic astrocytoma 3086 0.00163660761461716
ovarian cancer 8492 0.00552168674300319
medulloblastoma 1524 0.0109130879677004
atypical teratoid / rhabdoid tumor 4369 0.0173192268124663
osteosarcoma 7933 0.034952001399134

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.210 0.035
posterior fossa group B ependymoma 2.200 0.000
medulloblastoma -1.900 0.011
atypical teratoid / rhabdoid tumor -1.500 0.017
glioblastoma -2.000 0.001
medulloblastoma, large-cell -2.900 0.000
interstitial cystitis -1.800 0.002
pediatric high grade glioma -1.600 0.001
pilocytic astrocytoma -1.200 0.002
nasopharyngeal carcinoma -3.100 0.000
ovarian cancer 1.400 0.006

Synonym

Accession Q9H0I3 B2RAQ7 B4DR20 Q9NZX2
Symbols HSPC065

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MTDDESESVLSDSHEGSELELPVIQLCGLVEELSYVNSALKTETEMFEKYYAKLEPRDQRPPRLSEIKIS      1 - 70
AADYAQFRGRRRSKSRTGMDRGVGLTADQKLELVQKEVADMKDDLRHTRANAERDLQHHEAIIEEAEIRW     71 - 140
SEVSREVHEFEKDILKAISKKKGSILATQKVMKYIEDMNRRRDNMKEKLRLKNVSLKVQRKKMLLQLRQK    141 - 210
EEVSEALHDVDFQQLKIENAQFLETIEARNQELTQLKLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILL    211 - 280
RKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKVEIAEM    281 - 350
SLKGHRKAWNRMKITNEQLQADYLAGK                                               351 - 377
//

Text Mined References (12)

PMID Year Title
25074808 2014 Proteomic analysis of mammalian sperm cells identifies new components of the centrosome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...