Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.22
PubTator Score 0.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.210 0.035
posterior fossa group B ependymoma 2.200 0.000
medulloblastoma -1.900 0.011
atypical teratoid / rhabdoid tumor -1.500 0.017
glioblastoma -2.000 0.001
medulloblastoma, large-cell -2.900 0.000
interstitial cystitis -1.800 0.002
pediatric high grade glioma -1.600 0.001
pilocytic astrocytoma -1.200 0.002
nasopharyngeal carcinoma -3.100 0.000
ovarian cancer 1.400 0.006

Synonym

Accession Q9H0I3 B2RAQ7 B4DR20 Q9NZX2
Symbols HSPC065

Gene

AA Sequence

MTDDESESVLSDSHEGSELELPVIQLCGLVEELSYVNSALKTETEMFEKYYAKLEPRDQRPPRLSEIKIS      1 - 70
AADYAQFRGRRRSKSRTGMDRGVGLTADQKLELVQKEVADMKDDLRHTRANAERDLQHHEAIIEEAEIRW     71 - 140
SEVSREVHEFEKDILKAISKKKGSILATQKVMKYIEDMNRRRDNMKEKLRLKNVSLKVQRKKMLLQLRQK    141 - 210
EEVSEALHDVDFQQLKIENAQFLETIEARNQELTQLKLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILL    211 - 280
RKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKVEIAEM    281 - 350
SLKGHRKAWNRMKITNEQLQADYLAGK                                               351 - 377
//

Text Mined References (12)

PMID Year Title
25074808 2014 Proteomic analysis of mammalian sperm cells identifies new components of the centrosome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...