Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H0H9
Symbols C2orf14

Gene

 Compartment GO Term (1)

AA Sequence

MVTPAGCLGGRNQGPREIPGTAFPCSSRAGQTGQAVSGAQVSSWRERQPFGGSRGPLHILGTDGNVDTTG      1 - 70
KLGLVPTPPRIQKETKQGALCGMKPPFLPEALLTVWWLPFVAVSLCLF                           71 - 118
//

Text Mined References (4)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.