Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H0H9
Symbols C2orf14

Gene

 Compartment GO Term (1)

AA Sequence

MVTPAGCLGGRNQGPREIPGTAFPCSSRAGQTGQAVSGAQVSSWRERQPFGGSRGPLHILGTDGNVDTTG      1 - 70
KLGLVPTPPRIQKETKQGALCGMKPPFLPEALLTVWWLPFVAVSLCLF                           71 - 118
//

Text Mined References (4)

PMID Year Title