Property Summary

NCBI Gene PubMed Count 86
PubMed Score 52.96
PubTator Score 60.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.15977643854515E-27
adrenocortical carcinoma 1427 6.57804051822009E-9
oligodendroglioma 2849 2.81915209442107E-7
glioblastoma 5572 5.33568852426859E-7
medulloblastoma, large-cell 6234 1.74373155835631E-6
group 3 medulloblastoma 2254 3.39822874976674E-6
breast carcinoma 1614 9.54914322043862E-6
nasopharyngeal carcinoma 1056 1.00904260614358E-5
pancreatic cancer 2300 2.35798466506555E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.07547125735358E-5
lung cancer 4473 6.21856475135831E-5
hepatocellular carcinoma 550 6.49467417589215E-5
pediatric high grade glioma 2712 1.09266463838961E-4
Atopic dermatitis 944 2.78607949030481E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.52084484058814E-4
invasive ductal carcinoma 2950 4.64135201740209E-4
primary Sjogren syndrome 789 0.00143778231184675
lung adenocarcinoma 2714 0.00213266293636201
primitive neuroectodermal tumor 3031 0.00237920199186476
colon cancer 1475 0.00332718359099138
ovarian cancer 8492 0.00415632058276875
tuberculosis and treatment for 6 months 686 0.00460564869728478
pituitary cancer 1972 0.00484672292749182
ductal carcinoma in situ 1745 0.00676926693558276
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00922616525475811
cystic fibrosis and chronic rhinosinusitis 213 0.0110212052354454
Endometriosis 535 0.0167979370137855
Breast cancer 3099 0.0215258560780546

Expression

Synonym

Accession Q9H0H5 Q6PJ26 Q9NWN2 Q9P250 Q9P2W2
Symbols CYK4
ID-GAP
HsCYK-4
MgcRacGAP

Gene

PDB

5C2K   2OVJ   3W6R   3WPQ   3WPS   4B6D   5C2J  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
624330 confirmatory 2057 / 1883 / 338351 Discovery of small molecule inhibitors of the oncogenic and cytokinetic protein MgcRacGAP - Primary and Confirmatory Screens
624334 summary 0 / 0 / 0 of small molecule inhibitors of the oncogenic and cytokinetic protein MgcRacGAP - Summary
652142 other 0 / 0 / 2362 Biochemical MgcRacGAP assay detecting GTPase activation of the target GTPase Rac1 through the measurement of inorganic phosphate.
652153 confirmatory 4 / 0 / 43 Biochemical RhoGAP selectivity assay - MgcRacGAP inhibition

Gene RIF (38)

PMID Text
26508373 RACGAP1 expression levels in the nucleus and cytoplasm, determined by immunohistochemical staining, predict opposite clinical outcomes and that both could be independent prognostic markers for colorectal cancer.
26018753 RacGAP1 Is a Novel Downstream Effector of E2F7-Dependent Resistance to Doxorubicin and Is Prognostic for Overall Survival in Squamous Cell Carcinoma
25568185 High RacGAP1 expression was an independent predictive marker for lymph node metastasis, recurrence and poor prognosis in colorectal cancer patients.
25486482 central spindle assembly and 2 Plk1-dependent phosphorylations are required to establish efficient binding of the Ect2 BRCT in early cytokinesis.
25475728 RacGAP1 mediated endothelial barrier function loss and melanoma transmigration in a focal adhesion-dependent manner.RacGAP1 activation mediates focal adhesion assembly and actin stress fiber formation.
25305482 HCV viral protein NS5B polymerase activity was significantly reduced by silencing RacGAP1 and, vice versa, was increased by overexpression of RacGAP1 in a cell-based reporter assay.
24857844 We show that some are new substrates of the anaphase-promoting complex/cyclosome and validate KIFC1 and RacGAP1/Cyk4 as two such targets involved respectively in timely mitotic spindle disassembly and cell spreading
24807907 MgcRacGAP colocalizes with CGN and CGNL1 at TJs and forms a complex and interacts directly in vitro with CGN and CGNL1.
24615626 RacGAP1 expression at the invasive front in gastric cancer was significantly correlated with factors reflecting tumor progression and poor prognosis.RACGAP1 gene expression in diffuse type gastric cancer was elevated.
23696789 APC(CDH1) targets MgcRacGAP for destruction in the late M phase.
More...

AA Sequence

MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDV      1 - 70
KLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGN     71 - 140
KRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQ    141 - 210
GNESIVAKTTVTVPNDGGPIEAVSTIETVPYWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQS    211 - 280
NGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGM    281 - 350
LADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS    351 - 420
LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTK    421 - 490
MDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSN    491 - 560
AFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPM    561 - 630
LK                                                                        631 - 632
//

Text Mined References (93)

PMID Year Title
27185834 2016 Diaphanous formin mDia2 regulates CENP-A levels at centromeres.
26778597 2016 Expression of aurora kinase A correlates with the Wnt-modulator RACGAP1 in gastric cancer.
26602080 2015 MgcRacGAP inhibition stimulates JAK-dependent STAT3 activity.
26508373 2016 Opposing prognostic roles of nuclear and cytoplasmic RACGAP1 expression in colorectal cancer patients.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26252513 2015 The RhoGAP activity of CYK-4/MgcRacGAP functions non-canonically by promoting RhoA activation during cytokinesis.
26018753 2015 RacGAP1 Is a Novel Downstream Effector of E2F7-Dependent Resistance to Doxorubicin and Is Prognostic for Overall Survival in Squamous Cell Carcinoma.
25947135 2015 MgcRacGAP restricts active RhoA at the cytokinetic furrow and both RhoA and Rac1 at cell-cell junctions in epithelial cells.
25875822 2015 CYK4 promotes antiparallel microtubule bundling by optimizing MKLP1 neck conformation.
25568185 2015 RacGAP1 expression, increasing tumor malignant potential, as a predictive biomarker for lymph node metastasis and poor prognosis in colorectal cancer.
More...