Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.68
PubTator Score 0.40

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSVSVHETRKSRSSTGSMNVTLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRY      1 - 70
FEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENAESLLEAGDMLQFHDVRDAAAEFL     71 - 140
EKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVV    141 - 210
FEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADERTKLIMDEALRCKTRILQND    211 - 280
GVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPRKEFSASAIGCKVYVTGGRGS    281 - 350
ENGVSKDVWVYDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPG    351 - 420
ANKWMMVAPLRDGVSNAAVVSAKLKLFVFGGTSIHRDMVSKVQCYDPSENRWTIKAECPQPWRYTAAAVL    421 - 490
GSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQRCKTLDCYDP    491 - 560
TSDTWNCITTVPYSLIPTAFVSTWKHLPA                                             561 - 589
//

Text Mined References (16)

PMID Year Title
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23594818 2013 Evidence for shared genetic risk between methamphetamine-induced psychosis and schizophrenia.
22578813 2012 Translational homeostasis via the mRNA cap-binding protein, eIF4E.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...