Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.68
PubTator Score 6.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
acute quadriplegic myopathy 1158 2.0e-07
ovarian cancer 8520 5.1e-05
osteosarcoma 7950 8.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.195 2.0e-07
osteosarcoma 1.376 8.0e-05
ovarian cancer -1.300 5.1e-05

Gene RIF (4)

AA Sequence

MAIPGRQYGLILPKKTQQLHPVLQKPSVFGNDSDDDDETSVSESLQREAAKKQAMKQTKLEIQKALAEDA      1 - 70
TVYEYDSIYDEMQKKKEENNPKLLLGKDRKPKYIHNLLKAVEIRKKEQEKRMEKKIQREREMEKGEFDDK     71 - 140
EAFVTSAYKKKLQERAEEEEREKRAAALEACLDVTKQKDLSGFYRHLLNQAVGEEEVPKCSFREARSGIK    141 - 210
EEKSRGFSNEVSSKNRIPQEKCILQTDVKVEENPDADSDFDAKSSADDEIEETRVNCRREKVIETPENDF    211 - 280
KHHRSQNHSRSPSEERGHSTRHHTKGSRTSRGHEKREDQHQQKQSRDQENHYTDRDYRKERDSHRHREAS    281 - 350
HRDSHWKRHEQEDKPRARDQRERSDRVWKREKDREKYSQREQERDRQQNDQNRPSEKGEKEEKSKAKEEH    351 - 420
MKVRKERYENNDKYRDREKREVGVQSSERNQDRKESSPNSRAKDKFLDQERSNKMRNMAKDKERNQEKPS    421 - 490
NSESSLGAKHRLTEEGQEKGKEQERPPEAVSKFAKRNNEETVMSARDRYLARQMARVNAKTYIEKEDD      491 - 558
//

Text Mined References (28)

PMID Year Title