Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.65
PubTator Score 6.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.376 0.000
acute quadriplegic myopathy 1.195 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q9H0G5 Q6FI71
Symbols CCDC55
NSrp70
HSPC095

Gene

Gene RIF (4)

PMID Text
26797131 NSrp70 acts as a new molecular counterpart for alternative splicing of target RNA, counteracting SRSF1 and SRSF2 splicing activity.
26475744 Coiled coil domain-containing 55 gene may be involved in a functional bridging between the CNR1 activation and the disrupted in schizophrenia 1/Ran binding protein 9-associated pathways.
25176346 We showed that NSRP70 is a novel lymphoblastic acute leukemia surrogate marker
19047128 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAIPGRQYGLILPKKTQQLHPVLQKPSVFGNDSDDDDETSVSESLQREAAKKQAMKQTKLEIQKALAEDA      1 - 70
TVYEYDSIYDEMQKKKEENNPKLLLGKDRKPKYIHNLLKAVEIRKKEQEKRMEKKIQREREMEKGEFDDK     71 - 140
EAFVTSAYKKKLQERAEEEEREKRAAALEACLDVTKQKDLSGFYRHLLNQAVGEEEVPKCSFREARSGIK    141 - 210
EEKSRGFSNEVSSKNRIPQEKCILQTDVKVEENPDADSDFDAKSSADDEIEETRVNCRREKVIETPENDF    211 - 280
KHHRSQNHSRSPSEERGHSTRHHTKGSRTSRGHEKREDQHQQKQSRDQENHYTDRDYRKERDSHRHREAS    281 - 350
HRDSHWKRHEQEDKPRARDQRERSDRVWKREKDREKYSQREQERDRQQNDQNRPSEKGEKEEKSKAKEEH    351 - 420
MKVRKERYENNDKYRDREKREVGVQSSERNQDRKESSPNSRAKDKFLDQERSNKMRNMAKDKERNQEKPS    421 - 490
NSESSLGAKHRLTEEGQEKGKEQERPPEAVSKFAKRNNEETVMSARDRYLARQMARVNAKTYIEKEDD      491 - 558
//

Text Mined References (27)

PMID Year Title
26797131 2016 Nuclear Speckle-related Protein 70 Binds to Serine/Arginine-rich Splicing Factors 1 and 2 via an Arginine/Serine-like Region and Counteracts Their Alternative Splicing Activity.
26475744 2015 The CCDC55 couples cannabinoid receptor CNR1 to a putative DISC1 schizophrenia pathway.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25176346 2014 Aberrant proteomic expression of NSRP70 and its clinical implications and connection to the transcriptional level in adult acute leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21296756 2011 NSrp70 is a novel nuclear speckle-related protein that modulates alternative pre-mRNA splicing in vivo.
21269460 2011 Initial characterization of the human central proteome.
More...