Property Summary

NCBI Gene PubMed Count 39
PubMed Score 3.92
PubTator Score 26.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.700 2.1e-04
astrocytic glioma -1.500 3.0e-02
Astrocytoma, Pilocytic -1.100 7.7e-04
atypical teratoid / rhabdoid tumor -1.600 8.5e-06
ependymoma -1.200 3.9e-02
gastric cancer 1.100 5.7e-04
glioblastoma -1.400 3.8e-05
medulloblastoma -1.200 1.6e-02
medulloblastoma, large-cell -1.700 9.0e-04
oligodendroglioma -2.100 2.6e-02
osteosarcoma -1.185 1.3e-02
ovarian cancer -1.100 5.0e-03
Pick disease -1.300 1.2e-03
primitive neuroectodermal tumor -1.500 4.2e-04

Protein-protein Interaction (2)

Gene RIF (16)

AA Sequence

MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDM      1 - 70
SGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTS     71 - 140
VKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT                            141 - 186
//

Text Mined References (41)

PMID Year Title