Property Summary

NCBI Gene PubMed Count 29
Grant Count 18
R01 Count 15
Funding $5,540,810.26
PubMed Score 20.05
PubTator Score 19.09

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 0.015

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26600301 the roles of SHARPIN in inhibiting integrin activity and supporting linear ubiquitination are (molecularly) distinct.
26506596 Data show that SHANK-associated RH domain interacting protein (SHARPIN) gene expression in breast cancer patients predicts clinical outcomes.
25992689 progesterone significantly reduced SIPL1 mRNA and protein expression in MCF7 cells. As progesterone enhances breast cancer tumorigenesis in context dependent manner, inhibition of SIPL1 expression may contribute to progesterone's non-tumorigenic function
25443631 Sharpin deficiency sensitized primary murine keratinocytes, human keratinocytes, and mouse embryonic fibroblasts to TNF-induced apoptosis.
25152374 SIPL1 binds PTEN and enhances PTEN polyubiquitination.
25018115 SIPL1 promotes AKT activation by decreasing the amount of PTEN protein in CHO-K1 cells.
24210817 SHARPIN controls lymphocyte migration by endogenously maintaining LFA-1 inactive to allow adjustable detachment of the uropods in polarized cells.
22750873 crystals of SHARPIN belonged to the primitive tetragonal space group P4(3)2(1)2, with unit-cell parameters a = b = 61.55, c = 222.81 A
22549881 the crystal structure of the N-terminal portion of SHARPIN, which adopts the highly conserved pleckstrin homology superfold that is often used as a scaffold to create protein interaction modules
21947080 SHARPIN inhibits the critical switching of beta1-integrins from inactive to active conformations.
More...

AA Sequence

MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNL      1 - 70
EWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEAC     71 - 140
PVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQ    141 - 210
EACFPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPE    211 - 280
RSLASYGVRQDGDPAFLYLLSAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQP    281 - 350
SWSCPSCTFINAPDRPGCEMCSTQRPCTWDPLAAAST                                     351 - 387
//

Text Mined References (34)

PMID Year Title
27523608 2016 The Deubiquitinase OTULIN Is an Essential Negative Regulator of Inflammation and Autoimmunity.
27070702 2016 Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma.
26600301 2015 Mutually Exclusive Roles of SHARPIN in Integrin Inactivation and NF-?B Signaling.
26506596 2015 A novel gammaretroviral shuttle vector insertional mutagenesis screen identifies SHARPIN as a breast cancer metastasis gene and prognostic biomarker.
25992689 2015 Elevation of SIPL1 (SHARPIN) Increases Breast Cancer Risk.
25443631 2014 Sharpin prevents skin inflammation by inhibiting TNFR1-induced keratinocyte apoptosis.
25152374 2014 SIPL1-facilitated PTEN ubiquitination contributes to its association with PTEN.
25018115 2014 SIPL1 enhances the proliferation, attachment, and migration of CHO cells by inhibiting PTEN function.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24726323 2014 Molecular basis and regulation of OTULIN-LUBAC interaction.
More...