Property Summary

NCBI Gene PubMed Count 36
PubMed Score 25.40
PubTator Score 19.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Dermatitis 157 0.0 0.0
Eosinophilia 28 0.0 0.0
Disease Target Count P-value
non primary Sjogren syndrome sicca 891 1.5e-02

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 1.5e-02

Gene RIF (18)

AA Sequence

MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNL      1 - 70
EWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEAC     71 - 140
PVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQ    141 - 210
EACFPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPE    211 - 280
RSLASYGVRQDGDPAFLYLLSAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQP    281 - 350
SWSCPSCTFINAPDRPGCEMCSTQRPCTWDPLAAAST                                     351 - 387
//

Text Mined References (41)

PMID Year Title