Property Summary

NCBI Gene PubMed Count 23
PubMed Score 6.07
PubTator Score 29.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Endometriosis 540 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Distal muscular dystrophy 8 3.128 1.6

Expression

  Differential Expression (10)

Disease log2 FC p
dermatomyositis 1.600 8.9e-05
ependymoma 1.100 1.5e-02
juvenile dermatomyositis 1.011 6.0e-11
lung cancer 1.300 6.7e-04
Multiple myeloma 1.269 1.7e-02
oligodendroglioma 1.100 9.2e-03
osteosarcoma -1.114 3.5e-03
ovarian cancer -1.400 2.1e-05
pancreatic ductal adenocarcinoma liver m... 1.135 7.0e-03
Waldenstrons macroglobulinemia 1.069 2.1e-02

Gene RIF (5)

AA Sequence

MATGTGKHKLLSTGPTEPWSIREKLCLASSVMRSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSE      1 - 70
LLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAELIQAGHMDSRLDE     71 - 140
LCNDIATKKKLEEEEAEVKRKATDAAYQARQAVKTPPRRLPTVMVRSPIDSASPGGDYPLGDLTPTTMEE    141 - 210
ATSGVNESEMAVASGHLNSTGVLLEVGGVLPMIHGGEIQQTPNTVAASPAASGAPTLSRLLEAGPTQFTT    211 - 280
PLASFTTVASEPPVKLVPPPVESVSQATIVMMPALPAPSSAPAVSTTESVAPVSQPDNCVPMEAVGDPHT    281 - 350
VTVSMDSSEISMIINSIKEECFRSGVAEAPVGSKAPSIDGKEELDLAEKMDIAVSYTGEELDFETVGDII    351 - 420
AIIEDKVDDHPEVLDVAAVEAALSFCEENDDPQSLPGPWEHPIQQERDKPVPLPAPEMTVKQERLDFEET    421 - 490
ENKGIHELVDIREPSAEIKVEPAEPEPVISGAEIVAGVVPATSMEPPELRSQDLDEELGSTAAGEIVEAD    491 - 560
VAIGKGDETPLTNVKTEASPESMLSPSHGSNPIEDPLEAETQHKFEMSDSLKEESGTIFGSQIKDAPGED    561 - 630
EEEDGVSEAASLEEPKEEDQGEGYLSEMDNEPPVSESDDGFSIHNATLQSHTLADSIPSSPASSQFSVCS    631 - 700
EDQEAIQAQKIWKKAIMLVWRAAANHRYANVFLQPVTDDIAPGYHSIVQRPMDLSTIKKNIENGLIRSTA    701 - 770
EFQRDIMLMFQNAVMYNSSDHDVYHMAVEMQRDVLEQIQQFLATQLIMQTSESGISAKSLRGRDSTRKQD    771 - 840
ASEKDSVPMGSPAFLLSLFMGHEWVWLDSEQDHPNDSELSNDCRSLFSSWDSSLDLDVGNWRETEDPEAE    841 - 910
ELEESSPEREPSELLVGDGGSEESQEAARKASHQNLLHFLSEVAYLMEPLCISSNESSEGCCPPSGTRQE    911 - 980
GREIKASEGERELCRETEELSAKGDPLVAEKPLGENGKPEVASAPSVICTVQGLLTESEEGEAQQESKGE    981 - 1050
DQGEVYVSEMEDQPPSGECDDAFNIKETPLVDTLFSHATSSKLTDLSQDDPVQDHLLFKKTLLPVWKMIA   1051 - 1120
SHRFSSPFLKPVSERQAPGYKDVVKRPMDLTSLKRNLSKGRIRTMAQFLRDLMLMFQNAVMYNDSDHHVY   1121 - 1190
HMAVEMRQEVLEQIQVLNIWLDKRKGSSSLEGEPANPVDDGKPVF                            1191 - 1235
//

Text Mined References (37)

PMID Year Title