Property Summary

NCBI Gene PubMed Count 76
PubMed Score 81.58
PubTator Score 48.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.900 9.4e-06
astrocytic glioma -1.100 1.6e-02
Astrocytoma, Pilocytic -1.400 1.6e-07
atypical teratoid / rhabdoid tumor -2.200 3.6e-09
ependymoma -1.600 2.8e-02
esophageal adenocarcinoma -1.100 3.0e-02
glioblastoma -1.500 6.2e-08
group 3 medulloblastoma -1.300 3.2e-02
interstitial cystitis -1.300 1.5e-03
medulloblastoma, large-cell -1.300 3.7e-03
oligodendroglioma -1.300 7.5e-15
osteosarcoma -2.082 9.3e-07
pancreatic ductal adenocarcinoma liver m... -1.074 1.6e-02
Pick disease -1.200 3.7e-04
primitive neuroectodermal tumor -2.100 2.2e-05
psoriasis 1.100 7.2e-05

Protein-protein Interaction (7)

Gene RIF (50)

AA Sequence

MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGM      1 - 70
TRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPE     71 - 140
SLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCS    141 - 210
PGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP          211 - 274
//

Text Mined References (81)

PMID Year Title