Property Summary

NCBI Gene PubMed Count 67
Grant Count 21
R01 Count 10
Funding $1,118,633.63
PubMed Score 72.69
PubTator Score 48.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.700 0.017
posterior fossa group A ependymoma -1.700 0.000
esophageal adenocarcinoma -1.100 0.030
psoriasis 1.200 0.008
glioblastoma -1.900 0.000
oligodendroglioma -1.300 0.000
osteosarcoma -2.082 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -2.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.074 0.016
interstitial cystitis -1.300 0.002
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.400 0.000
Pick disease -1.200 0.000

Gene RIF (41)

PMID Text
26610735 These data suggest that M. leprae upregulates IL-1Ra by a TOLLIP-dependent mechanism; inhibition of TOLLIP may decrease an individual's susceptibility to leprosy and offer a novel therapeutic target for IL-1-dependent diseases.
26462859 Observed expression patterns of several TLR inhibitory proteins with a noticeable suppression in expression of two of these; PPARgamma and TOLLIP in both ulcerative colitis and Crohn's disease and in both active and inactive disease states.
26331942 TOLLIP encodes toll-interacting protein (TOLLIP), which is an inhibitory adaptor protein acting downstream from the toll-like receptors (TLRs). Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201505-1010OC#.VwqiYdLrvyA
26320582 Tom1 modulates binding of Tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism.
26110841 we identify a novel function of Tollip in regulating the canonical Wnt pathway which is evolutionarily conserved between fish and humans. Tollip-mediated inhibition of Wnt signaling may contribute to embryonic development and to carcinogenesis.
26107286 The two polymorphisms, rs5743899 and rs3750920, in the TOLLIP gene are independently associated with an increased risk of developing cutaneous leishmaniasis (CL).
26011492 Tollip acts as a novel modulator of I/R injury by promoting neuronal apoptosis and ischaemic inflammation, which are largely mediated by suppression of Akt signalling.
25915421 Study shows that host factor Tollip inhibits HIV LTR-driven gene expression by suppressing NF-kappaB activation revealing its novel role in modulating HIV-1 infection.
25765712 TOLLIP contributes to mortality following myocardial infarction through promoting inflammation and apoptosis
25275363 The MUC5B promoter polynmorphism, TOLLIP, is a strong risk factor for idiopathic pulmonary fibrosis in a Mexican population but is very rare in a Korean population.
More...

AA Sequence

MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGM      1 - 70
TRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPE     71 - 140
SLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCS    141 - 210
PGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP          211 - 274
//

Text Mined References (71)

PMID Year Title
26610735 2016 Genetic Variation in Toll-Interacting Protein Is Associated With Leprosy Susceptibility and Cutaneous Expression of Interleukin 1 Receptor Antagonist.
26462859 2016 Differential expression of key regulators of Toll-like receptors in ulcerative colitis and Crohn's disease: a role for Tollip and peroxisome proliferator-activated receptor gamma?
26331942 2015 TOLLIP, MUC5B, and the Response to N-Acetylcysteine among Individuals with Idiopathic Pulmonary Fibrosis.
26320582 2015 Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism.
26110841 2015 Endocytic Adaptor Protein Tollip Inhibits Canonical Wnt Signaling.
26107286 2015 Polymorphisms in the TOLLIP Gene Influence Susceptibility to Cutaneous Leishmaniasis Caused by Leishmania guyanensis in the Amazonas State of Brazil.
26011492 2015 Tollip is a critical mediator of cerebral ischaemia-reperfusion injury.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915421 2015 Toll-Interacting Protein Suppresses HIV-1 Long-Terminal-Repeat-Driven Gene Expression and Silences the Post-Integrational Transcription of Viral Proviral DNA.
25765712 2015 Toll-interacting protein contributes to mortality following myocardial infarction through promoting inflammation and apoptosis.
More...