Property Summary

NCBI Gene PubMed Count 45
PubMed Score 31.80
PubTator Score 30.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.1e-06
diabetes mellitus -1.200 2.8e-03
ependymoma 1.200 4.4e-02
glioblastoma 1.300 4.0e-05
group 3 medulloblastoma 1.300 1.3e-04
intraductal papillary-mucinous carcinoma... -1.100 4.4e-04
medulloblastoma, large-cell 1.600 9.1e-06
osteosarcoma 1.240 2.6e-04
ovarian cancer -1.700 2.1e-06
pediatric high grade glioma 1.400 8.8e-04
primitive neuroectodermal tumor 1.200 5.2e-06

Gene RIF (22)

AA Sequence

MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIHPCTHPEDKPA      1 - 70
PKNEDEMMVAIFEYIDRLFSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEGMEAAVEKQRVREEIL     71 - 140
AKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIADRLNNDPGWKNLTVILSDASAPGEGEHKIMD    141 - 210
YIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPKPCGLCNQFGHEVKDCEGLP    211 - 280
REKKGKHDELADSLPCAEGEFIFLRLNVLREYLERELTMASLPFTFDVERSIDDWVFMCFFVGNDFLPHL    281 - 350
PSLEIRENAIDRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKE    351 - 420
KRKRMKRDQPAFTPSGILTPHALGSRNSPGSQVASNPRQAAYEMRMQNNSSPSISPNTSFTSDGSPSPLG    421 - 490
GIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQSYVEGLCWVLRYYYQGCASW    491 - 560
KWYYPFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMGVFPAASGNFLPPSWRKLMSDPDSSIIDFYP    561 - 630
EDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELY    631 - 700
QTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVM    701 - 770
LPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVT    771 - 840
YQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQ    841 - 910
MLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN                                  911 - 950
//

Text Mined References (59)

PMID Year Title