Property Summary

NCBI Gene PubMed Count 39
Grant Count 16
R01 Count 12
Funding $1,788,974.25
PubMed Score 31.33
PubTator Score 30.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (19)

PMID Text
26728557 P-TEFb regulates termination by promoting chromatin recruitment and activation of a cotranscriptional RNA processing enzyme, Xrn2.
26531822 The results suggest that CARF regulates early steps of pre-rRNA processing during ribosome biogenesis by controlling spatial distribution of XRN2 between the nucleoplasm and nucleolus.
26474067 Kinetic competition between elongating pol II and the Xrn2 exonuclease is integral to termination of transcription on most human genes.
26340924 Chromatin immunoprecipitation experiments further show that IL-1 stimulation leads to decrease in NKRF aa 421-429 phosphorylation and dissociation of NELF-E and XRN2 by concomitant resumption of transcription elongation of a synthetic reporter
26159921 found that the 3' fragments of target pre-mRNA generated by ASO were almost completely degraded from their 5' ends by nuclear XRN2 after RNase H1-mediated cleavage
25673723 The restriction of JFH1 and H77D hepatitis C virus replication by Xrn2 is likely indirect in nature and possibly linked to cytopathic effects of these robustly replicating viruses.
25128458 Mammalian target of rapamycin protein regulates the diffusion of Xrn2 from the nucleolus to the nucleoplasm under heat stress conditions.
25121753 Xrn2 has a cytoplasmic, antiviral function against HCV that is counteracted by HCV's subversion of miR-122 to form a protective oligomeric complex at the 5' end of the viral genome.
25010285 Interaction of HIV-1 Gag with 5'-3' exoribonuclease 2 (XRN2) is identified in a series of six affinity purification/mass spectrometry screens
23857582 hnRNPK may play a role in recruitment of XRN2 to gene loci thus regulating coupling 3'-end pre-mRNA processing to transcription termination.
More...

AA Sequence

MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIHPCTHPEDKPA      1 - 70
PKNEDEMMVAIFEYIDRLFSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEGMEAAVEKQRVREEIL     71 - 140
AKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIADRLNNDPGWKNLTVILSDASAPGEGEHKIMD    141 - 210
YIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPKPCGLCNQFGHEVKDCEGLP    211 - 280
REKKGKHDELADSLPCAEGEFIFLRLNVLREYLERELTMASLPFTFDVERSIDDWVFMCFFVGNDFLPHL    281 - 350
PSLEIRENAIDRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKE    351 - 420
KRKRMKRDQPAFTPSGILTPHALGSRNSPGSQVASNPRQAAYEMRMQNNSSPSISPNTSFTSDGSPSPLG    421 - 490
GIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQSYVEGLCWVLRYYYQGCASW    491 - 560
KWYYPFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMGVFPAASGNFLPPSWRKLMSDPDSSIIDFYP    561 - 630
EDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELY    631 - 700
QTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVM    701 - 770
LPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVT    771 - 840
YQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQ    841 - 910
MLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN                                  911 - 950
//

Text Mined References (54)

PMID Year Title
26779609 2016 Structural basis and function of XRN2 binding by XTB domains.
26728557 2016 P-TEFb regulation of transcription termination factor Xrn2 revealed by a chemical genetic screen for Cdk9 substrates.
26700805 2016 SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination.
26531822 2015 Collaborator of alternative reading frame protein (CARF) regulates early processing of pre-ribosomal RNA by retaining XRN2 (5'-3' exoribonuclease) in the nucleoplasm.
26474067 2015 Effects of Transcription Elongation Rate and Xrn2 Exonuclease Activity on RNA Polymerase II Termination Suggest Widespread Kinetic Competition.
26340924 2016 NF-?B-repressing factor phosphorylation regulates transcription elongation via its interactions with 5'?3' exoribonuclease 2 and negative elongation factor.
26159921 2015 XRN2 is required for the degradation of target RNAs by RNase H1-dependent antisense oligonucleotides.
25673723 2015 Dissecting the roles of the 5' exoribonucleases Xrn1 and Xrn2 in restricting hepatitis C virus replication.
25128458 2014 mTOR regulates the nucleoplasmic diffusion of Xrn2 under conditions of heat stress.
25121753 2014 Hepatitis C virus subverts liver-specific miR-122 to protect the viral genome from exoribonuclease Xrn2.
More...