Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.90
PubTator Score 8.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.600 0.000

Gene RIF (5)

PMID Text
26460618 our data suggest an essential role of PINCH1, ILK and ILKAP for the radioresistance of p53-wildtype glioblastoma multiforme cells
25872452 The expression of ILKAP was considerably lower in eutopic and ectopic endometrial samples from women with endometriosis than in control endometrium. Expression varied depending on the phase of the menstrual cycle.
24743186 Data show involvement of ANXA5 and ILKAP in susceptibility to malignant melanoma
23329845 ILKAP is a nuclear protein that regulates cell survival and apoptosis through the regulation of RSK2 signaling.
21782789 these results suggested that palladin played a specific role in modulating the subcellular localization of the cytoplasmic ILKAP and promoting the ILKAP-induced apoptosis.

AA Sequence

MDLFGDLPEPERSPRPAAGKEAQKGPLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMV      1 - 70
KTEGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILNDITEECRPPSS     71 - 140
LITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQK    141 - 210
PAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRD    211 - 280
GRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKI    281 - 350
QTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH                                351 - 392
//

Text Mined References (23)

PMID Year Title
26460618 2015 ILKAP, ILK and PINCH1 control cell survival of p53-wildtype glioblastoma cells after irradiation.
25872452 2015 Endometrial ILKAP expression among patients with endometriosis and its association with clinical characteristics.
24743186 2014 Involvement of ANXA5 and ILKAP in susceptibility to malignant melanoma.
23329845 2013 Characterization of nuclear localization signal in the N terminus of integrin-linked kinase-associated phosphatase (ILKAP) and its essential role in the down-regulation of RSK2 protein signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21782789 2011 Palladin is a novel binding partner of ILKAP in eukaryotic cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...