Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.85
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Delayed Emergence from Anesthesia 2 0.0 0.0
Disease Target Count P-value
medulloblastoma 720 6.3e-06
ovarian cancer 8520 1.1e-04
atypical teratoid / rhabdoid tumor 5112 7.5e-04
Multiple myeloma 1332 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Kawasaki disease 28 0.0 0.9

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 7.5e-04
medulloblastoma -1.100 6.3e-06
Multiple myeloma 1.189 1.1e-02
ovarian cancer -1.400 1.1e-04

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (4)

AA Sequence

MASLGPAAAGEQASGAEAEPGPAGPPPPPSPSSLGPLLPLQREPLYNWQATKASLKERFAFLFNSELLSD      1 - 70
VRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAEIELPDVEPAAFLALLRFLYSDE     71 - 140
VQIGPETVMTTLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTMDA    141 - 210
ISAEGFTDIDIDTLCAVLERDTLSIRESRLFGAVVRWAEAECQRQQLPVTFGNKQKVLGKALSLIRFPLM    211 - 280
TIEEFAAGPAQSGILSDREVVNLFLHFTVNPKPRVEYIDRPRCCLRGKECCINRFQQVESRWGYSGTSDR    281 - 350
IRFTVNRRISIVGFGLYGSIHGPTDYQVNIQIIEYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPN    351 - 420
VCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT            421 - 482
//

Text Mined References (22)

PMID Year Title