Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.75
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 4.2e-02
intraductal papillary-mucinous carcinoma... 1.100 1.7e-02
medulloblastoma, large-cell -1.500 4.1e-03
non-small cell lung cancer 2.032 7.5e-14

Gene RIF (4)

AA Sequence

MGKDFRYYFQHPWSRMIVAYLVIFFNFLIFAEDPVSHSQTEANVIVVGNCFSFVTNKYPRGVGWRILKVL      1 - 70
LWLLAILTGLIAGKFLFHQRLFGQLLRLKMFREDHGSWMTMFFSTILFLFIFSHIYNTILLMDGNMGAYI     71 - 140
ITDYMGIRNESFMKLAAVGTWMGDFVTAWMVTDMMLQDKPYPDWGKSARAFWKKGNVRITLFWTVLFTLT    141 - 210
SVVVLVITTDWISWDKLNRGFLPSDEVSRAFLASFILVFDLLIVMQDWEFPHFMGDVDVNLPGLHTPHMQ    211 - 280
FKIPFFQKIFKEEYRIHITGKWFNYGIIFLVLILDLNMWKNQIFYKPHEYGQYIGPGQKIYTVKDSESLK    281 - 350
DLNRTKLSWEWRSNHTNPRTNKTYVEGDMFLHSRFIGASLDVKCLAFVPSLIAFVWFGFFIWFFGRFLKN    351 - 420
EPRMENQDKTYTRMKRKSPSEHSKDMGITRENTQASVEDPLNDPSLVCIRSDFNEIVYKSSHLTSENLSS    421 - 490
QLNESTSATEADQDPTTSKSTPTN                                                  491 - 514
//

Text Mined References (14)

PMID Year Title