Property Summary

NCBI Gene PubMed Count 17
PubMed Score 29.85
PubTator Score 21.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 1.9e-02
Disease Target Count Z-score Confidence
Testicular cancer 25 0.0 1.7
Disease Target Count Z-score Confidence
Koolen de Vries syndrome 18 4.019 2.0
Strongyloidiasis 9 3.853 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.200 1.9e-02

Gene RIF (7)

AA Sequence

MHREPAKKKAEKRLFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCL      1 - 70
VRIPREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGGAAGATSL     71 - 140
CVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRASYFGAYDTV    141 - 210
KGLLPKPKKTPFLVSFFIAQVVTTCSGILSYPFDTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSF    211 - 280
FRGAFSNVLRGTGGALVLVLYDKIKEFFHIDIGGR                                       281 - 315
//

Text Mined References (20)

PMID Year Title