Property Summary

NCBI Gene PubMed Count 17
Grant Count 7
Funding $448,677.61
PubMed Score 29.44
PubTator Score 21.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.200 0.019

Gene RIF (7)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
21827840 Data show the specific role of the ANT4 isoform in spermatozoid bioenergetics.
21532989 data define common and distinct biochemical characteristics of ANT4 in comparison to ANT1, 2 and 3 providing a basis for study of its unique adaptation to germ cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
20060930 data highlight a cytoprotective activity of ANT4, and provide a novel dichotomy in the ANT isoform sub-family with ANT1 and 3 isoforms functioning as pro-apoptotic while ANT2 and 4 isoforms render cells resistant to death inducing stimuli
19556438 Male mice with disruptions of Slc25a31 are sterile and display an early meiotic arrest phenotype.
17137571 The co-localization of SFEC and glycolytic enzymes in the fibrous sheath supports a growing literature that the principal piece of the flagellum is capable of generating and regulating ATP independently from mitochondrial oxidation in the mid-piece.

AA Sequence

MHREPAKKKAEKRLFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCL      1 - 70
VRIPREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGGAAGATSL     71 - 140
CVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRASYFGAYDTV    141 - 210
KGLLPKPKKTPFLVSFFIAQVVTTCSGILSYPFDTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSF    211 - 280
FRGAFSNVLRGTGGALVLVLYDKIKEFFHIDIGGR                                       281 - 315
//

Text Mined References (20)

PMID Year Title
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
21827840 2011 Computational analysis of the transcriptional regulation of the adenine nucleotide translocator isoform 4 gene and its role in spermatozoid glycolytic metabolism.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21532989 2011 Functional expression of human adenine nucleotide translocase 4 in Saccharomyces cerevisiae.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20060930 2010 The fourth isoform of the adenine nucleotide translocator inhibits mitochondrial apoptosis in cancer cells.
19556438 2009 Adenine nucleotide translocase 4 deficiency leads to early meiotic arrest of murine male germ cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17137571 2007 Compartmentalization of a unique ADP/ATP carrier protein SFEC (Sperm Flagellar Energy Carrier, AAC4) with glycolytic enzymes in the fibrous sheath of the human sperm flagellar principal piece.
More...