Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.1e-09
nasopharyngeal carcinoma 1058 9.0e-09
ependymoma 4679 2.1e-07
medulloblastoma, large-cell 6241 2.1e-03
astrocytic glioma 2597 9.6e-03
chronic rhinosinusitis 512 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.500 9.6e-03
chronic rhinosinusitis -1.283 3.4e-02
ependymoma 2.000 2.1e-07
medulloblastoma, large-cell -1.200 2.1e-03
nasopharyngeal carcinoma -1.500 9.0e-09
osteosarcoma -2.013 2.1e-09

AA Sequence

MNVIYPLAVPKGRRLCCEVCEAPAERVCAACTVTYYCGVVHQKADWDSIHEKICQLLIPLRTSMPFYNSE      1 - 70
EERQHGLQQLQQRQKYLIEFCYTIAQKYLFEGKHEDAVPAALQSLRFRVKLYGLSSVELVPAYLLLAEAS     71 - 140
LGLGRIVQAEEYLFQAQWTVLKSTDCSNATHSLLHRNLGLLYIAKKNYEEARYHLANDIYFASCAFGTED    141 - 210
IRTSGGYFHLANIFYDLKKLDLADTLYTKVSEIWHAYLNNHYQVLSQAHIQQMDLLGKLFENDTGLDEAQ    211 - 280
EAEAIRILTSILNIRESTSDKAPQKTIFVLKILVMFYYLMMNSSKAQEYGMRALSLAKEQQLDVHEQSTI    281 - 350
QELLSLISTEDHPIT                                                           351 - 365
//

Text Mined References (6)

PMID Year Title