Property Summary

NCBI Gene PubMed Count 30
Grant Count 12
R01 Count 10
Funding $1,184,745.04
PubMed Score 4.64
PubTator Score 6.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -1.100 0.000
glioblastoma -1.400 0.000
oligodendroglioma -1.200 0.000
posterior fossa group B ependymoma -1.700 0.000
sonic hedgehog group medulloblastoma -1.700 0.000
atypical teratoid/rhabdoid tumor -1.400 0.000
pediatric high grade glioma -1.200 0.000
pilocytic astrocytoma -1.300 0.000
lung carcinoma 1.200 0.000

Gene RIF (4)

PMID Text
26385635 a homozygous 216-bp deletion located at the non-coding upstream region of the KLC2 gene in patients with SPOAN syndrome causes overexpression of the gene
25668010 Results identified KLC2 as a novel target and of miR-125b in non-small-cell lung cancer (NSCLC) and show the oncogenic potential of KLC2 in the progression of NSCLC.
22470497 For the binding of cargos shared by KLC2, we propose a different site located within the groove but not involving N343.
19773350 Na,K-ATPase traffic toward the plasma membrane in alveolar epithelial cells is driven by kinesin-1, where KLC2 is the isoform regulating this process.

AA Sequence

MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIEL      1 - 70
GLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM     71 - 140
SQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYAS    141 - 210
QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPA    211 - 280
VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRA    281 - 350
LEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE    351 - 420
SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRKQGLDPASQTK    421 - 490
VVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSLRRSGSFGKLRDALRRSSEML    491 - 560
VKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSRTLSSSSMDLSRRSSLVG            561 - 622
//

Text Mined References (38)

PMID Year Title
26884162 2016 The light chains of kinesin-1 are autoinhibited.
26385635 2015 Overexpression of KLC2 due to a homozygous deletion in the non-coding region causes SPOAN syndrome.
25668010 2015 High expression of kinesin light chain-2, a novel target of miR-125b, is associated with poor clinical outcome of elderly non-small-cell lung cancer patients.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22470497 2012 Crystal structures of the tetratricopeptide repeat domains of kinesin light chains: insight into cargo recognition mechanisms.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...