Property Summary

NCBI Gene PubMed Count 31
PubMed Score 5.05
PubTator Score 6.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -1.100 1.9e-20
Astrocytoma, Pilocytic -1.300 2.4e-06
atypical teratoid / rhabdoid tumor -1.100 3.8e-04
ependymoma -1.500 3.2e-12
glioblastoma -1.400 1.4e-09
group 3 medulloblastoma -1.100 5.1e-03
lung carcinoma 1.200 6.2e-34
oligodendroglioma -1.200 5.5e-16
pediatric high grade glioma -1.200 4.5e-06

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIEL      1 - 70
GLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM     71 - 140
SQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYAS    141 - 210
QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPA    211 - 280
VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRA    281 - 350
LEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE    351 - 420
SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRKQGLDPASQTK    421 - 490
VVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSLRRSGSFGKLRDALRRSSEML    491 - 560
VKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSRTLSSSSMDLSRRSSLVG            561 - 622
//

Text Mined References (39)

PMID Year Title