Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.25
PubTator Score 0.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.200 5.2e-03
group 4 medulloblastoma -1.400 1.1e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.2e-02
Pick disease -1.100 9.7e-04

Gene RIF (1)

AA Sequence

MAEGGELMSRLLSENADLKKQVRLLKENQMLRRLLSQSCQEGGGHDLLPPRAHAYPEAGSPGSGVPDFGR      1 - 70
FTSVADTPSQLQTSSLEDLLCSHAPLSSEDDTSPGCAAPSQAPFKAFLSPPEPHSHRGTDRKLSPLLSPL     71 - 140
QDSLVDKTLLEPREMVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLDRRILAY    141 - 210
VFPGVTRLYGFTVANIPEKIEQTSTKSLDGSVDERKLRELTQRYLALSARLEKLGYSRDVHPAFSEFLIN    211 - 280
TYGILKQRPDLRANPLHSSPAALRKLVIDVVPPKFLGDSLLLLNCLCELSKEDGKPLFAW              281 - 340
//

Text Mined References (12)

PMID Year Title